DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TPM2 and lev-11

DIOPT Version :9

Sequence 1:XP_016870576.1 Gene:TPM2 / 7169 HGNCID:12011 Length:303 Species:Homo sapiens
Sequence 2:NP_001021695.1 Gene:lev-11 / 173319 WormBaseID:WBGene00002978 Length:284 Species:Caenorhabditis elegans


Alignment Length:215 Identity:115/215 - (53%)
Similarity:161/215 - (74%) Gaps:0/215 - (0%)


- Green bases have known domain annotations that are detailed below.


Human     1 MDAIKKKMQMLKLDKENAIDRAEQAEADKKQAEDRCKQLEEEQQALQKKLKGTEDEVEKYSESVK 65
            |||||||||.:|::|:||:|||:.||...:|..::.:::|||.:..|||:..|.|:::|..|.:.
 Worm     1 MDAIKKKMQAMKIEKDNALDRADAAEEKVRQITEKLERVEEELRDTQKKMTQTGDDLDKAQEDLS 65

Human    66 EAQEKLEQAEKKATDAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVI 130
            .|..|||:.||...:|||:|||||||:.|:||||:||:|||..|.:|||||....|||||..||:
 Worm    66 AATSKLEEKEKTVQEAEAEVASLNRRMTLLEEELERAEERLKIATEKLEEATHNVDESERVRKVM 130

Human   131 ENRAMKDEEKMELQEMQLKEAKHIAEDSDRKYEEVARKLVILEGELERSEERAEVAESRARQLEE 195
            |||:::|||:....|.|||||:.:||::||||:||||||.::|.:|||:|||||..|::..:|||
 Worm   131 ENRSLQDEERANTVEAQLKEAQLLAEEADRKYDEVARKLAMVEADLERAEERAEAGENKIVELEE 195

Human   196 ELRTMDQALKSLMASEEEVV 215
            |||.:...||||..|||:.:
 Worm   196 ELRVVGNNLKSLEVSEEKAL 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TPM2XP_016870576.1 None
lev-11NP_001021695.1 Tropomyosin 48..282 CDD:278679 92/168 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C161454680
Domainoid 1 1.000 268 1.000 Domainoid score I1100
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 316 1.000 Inparanoid score I1734
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48449
OrthoDB 1 1.010 - - D1576041at2759
OrthoFinder 1 1.000 - - FOG0002679
OrthoInspector 1 1.000 - - otm15181
orthoMCL 1 0.900 - - OOG6_101961
Panther 1 1.100 - - O PTHR19269
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X463
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1211.910

Return to query results.
Submit another query.