DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TPH1 and ple

DIOPT Version :9

Sequence 1:NP_004170.1 Gene:TPH1 / 7166 HGNCID:12008 Length:444 Species:Homo sapiens
Sequence 2:NP_001286955.1 Gene:ple / 38746 FlyBaseID:FBgn0005626 Length:579 Species:Drosophila melanogaster


Alignment Length:436 Identity:191/436 - (43%)
Similarity:289/436 - (66%) Gaps:8/436 - (1%)


- Green bases have known domain annotations that are detailed below.


Human     7 ENKDHSLERGRASLIFSLKNEVGGLIKALKIFQEKHVNLLHIESRKSKRRNSEFEIFVDCDINRE 71
            |:.|.......|:|:..||..:..|.:.||..:..|..:.|:|||:|:....:.::.:..|:.|.
  Fly   148 ESSDAEAAMQSAALVVRLKEGISSLGRILKAIETFHGTVQHVESRQSRVEGVDHDVLIKLDMTRG 212

Human    72 QLNDIFHLLKSHTNVLSVNL--PDNFTLKEDGMETVPWFPKKISDLDHCANRVLMYGSELDADHP 134
            .|..:...|:...:..|:||  .:|..:|      .|||||..|:||:|.:.:..|..:||.:||
  Fly   213 NLLQLIRSLRQSGSFSSMNLMADNNLNVK------APWFPKHASELDNCNHLMTKYEPDLDMNHP 271

Human   135 GFKDNVYRKRRKYFADLAMNYKHGDPIPKVEFTEEEIKTWGTVFQELNKLYPTHACREYLKNLPL 199
            ||.|.|||:|||..|::|..||:|||||.:::::.|:|||.:||:.:..|.|.|||.||......
  Fly   272 GFADKVYRQRRKEIAEIAFAYKYGDPIPFIDYSDVEVKTWRSVFKTVQDLAPKHACAEYRAAFQK 336

Human   200 LSKYCGYREDNIPQLEDVSNFLKERTGFSIRPVAGYLSPRDFLSGLAFRVFHCTQYVRHSSDPFY 264
            |.....:.|..:|||:::|:||::.||||:||.||.|:.||||:.||||:|..||||||.:.|::
  Fly   337 LQDEQIFVETRLPQLQEMSDFLRKNTGFSLRPAAGLLTARDFLASLAFRIFQSTQYVRHVNSPYH 401

Human   265 TPEPDTCHELLGHVPLLAEPSFAQFSQEIGLASLGASEEAVQKLATCYFFTVEFGLCKQDGQLRV 329
            |||||:.||||||:||||:||||||||||||||||||:|.::||:|.|:|||||||||:.||::.
  Fly   402 TPEPDSIHELLGHMPLLADPSFAQFSQEIGLASLGASDEEIEKLSTVYWFTVEFGLCKEHGQIKA 466

Human   330 FGAGLLSSISELKHALSGHAKVKPFDPKITCKQECLITTFQDVYFVSESFEDAKEKMREFTKTIK 394
            :|||||||..||.||:|...:.:.|:|..|..|......:|.:|:|:|||||||:|.|.:..|:.
  Fly   467 YGAGLLSSYGELLHAISDKCEHRAFEPASTAVQPYQDQEYQPIYYVAESFEDAKDKFRRWVSTMS 531

Human   395 RPFGVKYNPYTRSIQILKDTKSITSAMNELQHDLDVVSDALAKVSR 440
            |||.|::||:|..:::|.....:.:.::::..::..:::|::|:.|
  Fly   532 RPFEVRFNPHTERVEVLDSVDKLETLVHQMNTEILHLTNAISKLRR 577

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TPH1NP_004170.1 Trp_5_monoox 3..439 CDD:130337 190/433 (44%)
pleNP_001286955.1 Tyr_3_monoox 130..576 CDD:130336 190/433 (44%)
ACT 130..234 CDD:298841 22/85 (26%)
Biopterin_H 243..573 CDD:278766 165/329 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D361696at33208
OrthoFinder 1 1.000 - - FOG0000587
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.