DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TPD52L2 and CG5174

DIOPT Version :9

Sequence 1:NP_955392.1 Gene:TPD52L2 / 7165 HGNCID:12007 Length:229 Species:Homo sapiens
Sequence 2:NP_001246407.1 Gene:CG5174 / 37117 FlyBaseID:FBgn0034345 Length:369 Species:Drosophila melanogaster


Alignment Length:210 Identity:57/210 - (27%)
Similarity:103/210 - (49%) Gaps:33/210 - (15%)


- Green bases have known domain annotations that are detailed below.


Human     2 DSAGQDINLNSPNKGLLSDSMTDV-----PVDTGVAARTPAVEGLTEAEEEELR-----AELTKV 56
            |:..:.:|:...::|...|:..::     |.::..:|...|.......||:|.|     .||.:|
  Fly   133 DNYKRFLNIGHRSRGTKFDNTANLSEPASPANSVASAEIAAEFAALSVEEKEQRRAEWSQELARV 197

Human    57 EEEIVTLRQVLAAKERHCGELKRRLGLSTLGELKQNLSRSWHDVQVSSAYVKTSEKLGEWNEKVT 121
            ||||.|||.|||:|.||..:|||:||::...|:..::::...:::.|:.|....:.:|.:.:.|.
  Fly   198 EEEINTLRTVLASKTRHASDLKRKLGITVWKEVTDDVNQGLKNLKESTVYQSVEQSVGTFTKTVY 262

Human   122 QSDLYKKTQETLSQAGQKTSAALSTVGSAISRKLGDMRAHPFSHSFSSYSIRHSISMPAMRNSAT 186
            ::.||::|:..|...|:||::...::.|.||.||..                       |:||.:
  Fly   263 EAPLYQRTESVLKSTGEKTASVFGSITSGISSKLSQ-----------------------MKNSES 304

Human   187 FKSFEDRVGTIKSKV 201
            .:|.|..||:....|
  Fly   305 MRSIEASVGSAYENV 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TPD52L2NP_955392.1 TPD52 <55..220 CDD:282107 44/147 (30%)
CG5174NP_001246407.1 TPD52 158..314 CDD:282107 51/178 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165146210
Domainoid 1 1.000 54 1.000 Domainoid score I11225
eggNOG 1 0.900 - - E1_KOG4010
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 100 1.000 Inparanoid score I5001
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1225782at2759
OrthoFinder 1 1.000 - - FOG0000981
OrthoInspector 1 1.000 - - otm41657
orthoMCL 1 0.900 - - OOG6_107924
Panther 1 1.100 - - LDO PTHR19307
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4903
SonicParanoid 1 1.000 - - X5007
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.790

Return to query results.
Submit another query.