DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TP53 and p53

DIOPT Version :9

Sequence 1:NP_000537.3 Gene:TP53 / 7157 HGNCID:11998 Length:393 Species:Homo sapiens
Sequence 2:NP_996267.1 Gene:p53 / 2768677 FlyBaseID:FBgn0039044 Length:495 Species:Drosophila melanogaster


Alignment Length:282 Identity:65/282 - (23%)
Similarity:116/282 - (41%) Gaps:44/282 - (15%)


- Green bases have known domain annotations that are detailed below.


Human   126 YSPALNKMFCQLAKTCPVQLWVDSTPP-PGTRVRAMAIYKQSQHMTEVVRRCPHHERCS--DSDG 187
            ||..|||::.::.|...|.:...|..| ....:|....:  |..::..|.||.:|....  .::.
  Fly   217 YSIPLNKLYIRMNKAFNVDVQFKSKMPIQPLNLRVFLCF--SNDVSAPVVRCQNHLSVEPLTANN 279

Human   188 LAPPQHLIRVE-------GNLRVEYLDDRNTFRHSVVVPY----EPPEVGSDCTTIHYNYMCNSS 241
            ....:.|:|.|       ||.:.:.:.:    |.|||||.    .....|....|:.:.::|.:|
  Fly   280 AKMRESLLRSENPNSVYCGNAQGKGISE----RFSVVVPLNMSRSVTRSGLTRQTLAFKFVCQNS 340

Human   242 CMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKK-----GEPHHELPP 301
            |:|   |:....:..||.:.|:::|::...|::|.||.|||..:|..|..|     .|...|..|
  Fly   341 CIG---RKETSLVFCLEKACGDIVGQHVIHVKICTCPKRDRIQDERQLNSKKRKSVPEAAEEDEP 402

Human   302 GSTKRALPNNT-------------SSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDA 353
            ...:|.:...|             |::.....:..||:| .|.|....:..:.:.:...::...|
  Fly   403 SKVRRCIAIKTEDTESNDSRDCDDSAAEWNVSRTPDGDY-RLAITCPNKEWLLQSIEGMIKEAAA 466

Human   354 QAGKEPG--GSRAHSSHLKSKK 373
            :..:.|.  ..|.|::.|.|.|
  Fly   467 EVLRNPNQENLRRHANKLLSLK 488

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TP53NP_000537.3 Interaction with CCAR2. /evidence=ECO:0000269|PubMed:25732823 1..320 53/225 (24%)
Interaction with HRMT1L2. /evidence=ECO:0000269|PubMed:15186775 1..83
Transcription activation (acidic) 1..44
P53_TAD 6..30 CDD:369955
TADI 17..25
TAD2 35..59 CDD:375947
TADII 48..56
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 50..96
Interaction with WWOX 66..110
Interaction with HIPK1. /evidence=ECO:0000250 100..370 62/277 (22%)
Required for interaction with ZNF385A. /evidence=ECO:0000269|PubMed:17719541 100..300 49/192 (26%)
P53 109..288 CDD:176262 45/175 (26%)
Required for interaction with FBXO42. /evidence=ECO:0000269|PubMed:19509332 113..236 28/123 (23%)
Interaction with AXIN1. /evidence=ECO:0000250 116..292 46/179 (26%)
Interaction with the 53BP2 SH3 domain 241..248 3/6 (50%)
Interaction with E4F1. /evidence=ECO:0000269|PubMed:10644996 256..294 14/42 (33%)
Interaction with DNA 273..280 3/6 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 282..325 10/60 (17%)
Interaction with CARM1. /evidence=ECO:0000269|PubMed:15186775 300..393 16/89 (18%)
Bipartite nuclear localization signal 305..321 3/28 (11%)
Interaction with HIPK2 319..360 6/40 (15%)
P53_tetramer 319..355 CDD:369476 6/35 (17%)
Oligomerization 325..356 5/30 (17%)
Nuclear export signal 339..350 0/10 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 351..393 7/25 (28%)
Interaction with USP7 359..363 1/5 (20%)
Basic (repression of DNA-binding) 368..387 3/6 (50%)
[KR]-[STA]-K motif 370..372 0/1 (0%)
p53NP_996267.1 P53 203..383 CDD:176262 44/174 (25%)
P53_C 429..495 CDD:288471 12/61 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147023
Domainoid 1 1.000 65 1.000 Domainoid score I10037
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S8089
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002925
OrthoInspector 1 1.000 - - otm41285
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR11447
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5172
SonicParanoid 1 1.000 - - X6184
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
109.880

Return to query results.
Submit another query.