DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TNR and CG9500

DIOPT Version :9

Sequence 1:NP_003276.3 Gene:TNR / 7143 HGNCID:11953 Length:1358 Species:Homo sapiens
Sequence 2:NP_609018.3 Gene:CG9500 / 33888 FlyBaseID:FBgn0031804 Length:292 Species:Drosophila melanogaster


Alignment Length:293 Identity:96/293 - (32%)
Similarity:153/293 - (52%) Gaps:36/293 - (12%)


- Green bases have known domain annotations that are detailed below.


Human  1073 LTYKSTDGSRKELIVDAE----DTWIRLEGLLENTDYTVLLQAAQDTTWSSIT-------STAFT 1126
            |::.||:.      :|:|    ||.||.:..|::. |.::|...::...::.|       |...|
  Fly    13 LSFYSTEA------MDSESFQNDTAIRNKPELKSL-YKLVLALLEENQSNASTENIQKSSSDLNT 70

Human  1127 TG--GRVFPHPQDCAQHLMNGDTLSGVYPIFLNGELSQKLQVYCDMTTDGGGWIVFQRRQNGQTD 1189
            ||  ||   :|..|..:    ....|:|.:.:.|  .:..||.||....|.||.|..||.:.:.:
  Fly    71 TGLSGR---YPSQCPTY----PPAHGIYTVQVLG--LKPFQVSCDAEIAGTGWTVMARRTSNKLN 126

Human  1190 FFRKWADYRVGFGNVEDEFWLGLDNIHRITSQGRYELRVDMRDGQ-EAAFASYDRFSVEDSRNLY 1253
            |||.||:|:.|||.::.:|::|||.:|.||....:||.:.:.|.: :..:|.||...:|.....|
  Fly   127 FFRSWAEYKNGFGQLDGDFFIGLDKLHAITKSQPHELYIHLEDFEGQTRYAHYDEIFIESENKFY 191

Human  1254 KL-RIGSYNGTAGDSLSYHQGRPFSTEDRDNDVAVTNCAMSYKGAWWYKNCHRTNLNGKY----- 1312
            .: ::|.:.|.||||:.:::.:.|||.|||||....|||..|.||||:.||..:||.|.|     
  Fly   192 AMTKLGEFTGDAGDSMIHNRNQNFSTFDRDNDGWHKNCAEEYVGAWWHLNCTYSNLFGIYVKGDE 256

Human  1313 GESRHSQGINWYHWKGHEFSIPFVEMKMRPYNH 1345
            |:....:||.|:.|:...:|...::|.:||..|
  Fly   257 GQYFQWKGIVWHSWRTESYSYKVMQMMVRPKCH 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TNRNP_003276.3 EGF_2 <208..230 CDD:285248
EGF_2 267..292 CDD:285248
EGF_2 299..323 CDD:285248
fn3 328..398 CDD:278470
fn3 416..496 CDD:278470
fn3 505..583 CDD:278470
FN3 595..679 CDD:238020
fn3 687..766 CDD:278470
fn3 776..855 CDD:278470
fn3 865..944 CDD:278470
fn3 954..1026 CDD:278470
FN3 1042..1127 CDD:238020 14/64 (22%)
FReD 1133..1342 CDD:238040 74/215 (34%)
CG9500NP_609018.3 FReD 76..287 CDD:238040 76/219 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100073
Panther 1 1.100 - - O PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.