DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TNNT2 and up

DIOPT Version :9

Sequence 1:NP_001263274.1 Gene:TNNT2 / 7139 HGNCID:11949 Length:298 Species:Homo sapiens
Sequence 2:NP_001162742.1 Gene:up / 32314 FlyBaseID:FBgn0004169 Length:397 Species:Drosophila melanogaster


Alignment Length:293 Identity:94/293 - (32%)
Similarity:142/293 - (48%) Gaps:63/293 - (21%)


- Green bases have known domain annotations that are detailed below.


Human    31 EDEQEEAAEEDAEAEAETEETRAEEDEEEEEAKEAEDGPMEESKPKPRSFMPNLVPPKIPDGERV 95
            :||:..::||:...|...|||:..:...|.|..                  |..:  |..|.:|.
  Fly     3 DDEEYTSSEEEEVVEETREETKPPQTPAEGEGD------------------PEFI--KRQDQKRS 47

Human    96 DFDDIHRKRMEKDLNELQALIEAHFENRKKEEEELVSLKDRIERRRAERAEQQR---IRNEREKE 157
            |.||           :|:..|....:.|.|||:||..||::..:|:..|||:::   .|.:.|:|
  Fly    48 DLDD-----------QLKEYITEWRKQRSKEEDELKKLKEKQAKRKVTRAEEEQKMAQRKKEEEE 101

Human   158 RQNRLAEERARREEEENRRKAEDEARKKKALSNMM--------HF-------GGYIQKQAQTERK 207
            |:.|.|||:.:||.||.|.:.|:..:|::|:...|        :|       |......|..||.
  Fly   102 RRVREAEEKKQREIEEKRMRLEEAEKKRQAMLQAMKDKDKKGPNFTIAKKDAGVLGLSSAAMERN 166

Human   208 SGKRQTEREKKKKILAERRKVLAIDHLNEDQLREKAKELWQSIYNLEAEKFDLQEKFKQQKYEIN 272
            ..|.|.|.|||.. |:.|.|.|||:...|.:|||||:|||:.|..||.||:||:|:.|:|.|::.
  Fly   167 KTKEQLEEEKKIS-LSFRIKPLAIEGFGEAKLREKAQELWELIVKLETEKYDLEERQKRQDYDLK 230

Human   273 VLRNRINDNQKVSKTRGKA--------KVTGRW 297
            .|:.|    || .:.|.||        .:||::
  Fly   231 ELKER----QK-QQLRHKALKKGLDPEALTGKY 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TNNT2NP_001263274.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..95 13/63 (21%)
Troponin 103..241 CDD:307228 50/155 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 120..219 39/116 (34%)
upNP_001162742.1 Troponin 156..>233 CDD:395788 35/77 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156938
Domainoid 1 1.000 50 1.000 Domainoid score I11672
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I4736
Isobase 1 0.950 - 1 Normalized mean entropy S6639
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm41072
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR11521
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
98.900

Return to query results.
Submit another query.