DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TNNT2 and Tnnt2

DIOPT Version :9

Sequence 1:NP_001263274.1 Gene:TNNT2 / 7139 HGNCID:11949 Length:298 Species:Homo sapiens
Sequence 2:XP_006249902.1 Gene:Tnnt2 / 24837 RGDID:3882 Length:329 Species:Rattus norvegicus


Alignment Length:307 Identity:267/307 - (86%)
Similarity:277/307 - (90%) Gaps:15/307 - (4%)


- Green bases have known domain annotations that are detailed below.


Human     1 MSDIEEVVEEYEEEEQEEAAVEEEEDW-REDEDEQEEAAEE-------DAEAEAETEETRAEEDE 57
            |||.||.|.|| |||||||.  ||||| .|:|||||||.||       |.|.|||.||.:|||..
  Rat    29 MSDAEEEVVEY-EEEQEEAV--EEEDWSEEEEDEQEEAVEEEDGEAEPDPEGEAEAEEDKAEEVG 90

Human    58 EEEEAKEAEDGPMEESKPKP-RSFMPNLVPPKIPDGERVDFDDIHRKRMEKDLNELQALIEAHFE 121
            .:|||::|||||:|:||||| |.||||||||||||||||||||||||||||||||||.|||||||
  Rat    91 PDEEARDAEDGPVEDSKPKPSRLFMPNLVPPKIPDGERVDFDDIHRKRMEKDLNELQTLIEAHFE 155

Human   122 NRKKEEEELVSLKDRIERRRAERAEQQRIRNEREKERQNRLAEERARREEEENRRKAEDEARKKK 186
            |||||||||:|||||||:|||||||||||||||||||||||||||||||||||||||||||||||
  Rat   156 NRKKEEEELISLKDRIEKRRAERAEQQRIRNEREKERQNRLAEERARREEEENRRKAEDEARKKK 220

Human   187 ALSNMMHFGGYIQKQAQTERKSGKRQTEREKKKKILAERRKVLAIDHLNEDQLREKAKELWQSIY 251
            ||||||||||||||   |||||||||||||||||||||||||||||||||||||||||||||||:
  Rat   221 ALSNMMHFGGYIQK---TERKSGKRQTEREKKKKILAERRKVLAIDHLNEDQLREKAKELWQSIH 282

Human   252 NLEAEKFDLQEKFKQQKYEINVLRNRINDNQKVSKTRGKAKVTGRWK 298
            |||||||||||||||||||||||||||||||||||||||||||||||
  Rat   283 NLEAEKFDLQEKFKQQKYEINVLRNRINDNQKVSKTRGKAKVTGRWK 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TNNT2NP_001263274.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..95 69/102 (68%)
Troponin 103..241 CDD:307228 131/137 (96%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 120..219 93/98 (95%)
Tnnt2XP_006249902.1 Troponin 137..272 CDD:279349 131/137 (96%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C83689928
Domainoid 1 1.000 259 1.000 Domainoid score I18244
eggNOG 00.000 Not matched by this tool.
HGNC 1 1.500 - -
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H68050
Inparanoid 1 1.050 505 1.000 Inparanoid score I11666
NCBI 1 1.000 - -
OMA 1 1.010 - - QHG40645
OrthoDB 1 1.010 - - D1480247at2759
OrthoFinder 1 1.000 - - FOG0001446
OrthoInspector 1 1.000 - - oto137629
orthoMCL 1 0.900 - - OOG6_113610
Panther 1 1.100 - - LDO PTHR11521
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X9722
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1616.410

Return to query results.
Submit another query.