DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TNNC1 and Cam

DIOPT Version :9

Sequence 1:NP_003271.1 Gene:TNNC1 / 7134 HGNCID:11943 Length:161 Species:Homo sapiens
Sequence 2:NP_001246276.1 Gene:Cam / 36329 FlyBaseID:FBgn0000253 Length:149 Species:Drosophila melanogaster


Alignment Length:148 Identity:76/148 - (51%)
Similarity:108/148 - (72%) Gaps:4/148 - (2%)


- Green bases have known domain annotations that are detailed below.


Human    10 EQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDF 74
            :||||||..|||.||.:|.... ||.|:|||||.|||.||||||..|||:||:|||.||:||:||
  Fly     3 DQLTEEQIAEFKEAFSLFDKDG-DGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDF 66

Human    75 DEFLVMMVRCMKDDSKGKSEEELSDLFRMFDKNADGYIDLDELKIMLQATGETITEDDIEELMKD 139
            .|||.||.|.|||..   ||||:.:.||:|||:.:|:|...||:.::...||.:|:::::|::::
  Fly    67 PEFLTMMARKMKDTD---SEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIRE 128

Human   140 GDKNNDGRIDYDEFLEFM 157
            .|.:.||:::|:||:..|
  Fly   129 ADIDGDGQVNYEEFVTMM 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TNNC1NP_003271.1 PTZ00184 9..157 CDD:185504 75/146 (51%)
CamNP_001246276.1 PTZ00184 1..149 CDD:185504 76/148 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1386217at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.