DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TNNC1 and TpnC47D

DIOPT Version :10

Sequence 1:NP_003271.1 Gene:TNNC1 / 7134 HGNCID:11943 Length:161 Species:Homo sapiens
Sequence 2:NP_476968.1 Gene:TpnC47D / 36195 FlyBaseID:FBgn0010423 Length:155 Species:Drosophila melanogaster


Alignment Length:184 Identity:38/184 - (20%)
Similarity:58/184 - (31%) Gaps:82/184 - (44%)


- Green bases have known domain annotations that are detailed below.


Human    74 VLQEVELRLLG---------------EAACQ---------CLYSRPG-------------PFNLT 101
            :::|.|..::|               .::|.         |.||..|             .|.||
  Fly   214 IIKETEQLIVGTVKVKNLSYHKEVIIRSSCDSWKTHEDTFCTYSVVGNGAASAYLIFDTFSFKLT 278

Human   102 FQLLPGM-----LCAGYPAGRRDTCQG----DSGGPLVCEDGGRW--------------FLAGIT 143
               ||..     .||.|      .|.|    |:      .||..:              ||:..:
  Fly   279 ---LPPKSRRIEFCAAY------KCDGVEYWDN------NDGRNYSLTNRIAPRENSGAFLSSSS 328

Human   144 SFGFGCGRRN-RPGVFTAVAPYESWIREHVMGSEPGPV---FPSQLQKPQSGPW 193
            :..|.....| |.|:..|.|..:.:|..:|   :||.|   :.....:.||||:
  Fly   329 ASAFNSAAPNGRNGLAAAAAASDGFISPYV---DPGAVLDTWSDMSVETQSGPY 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TNNC1NP_003271.1 PTZ00184 9..157 CDD:185504 26/143 (18%)
TpnC47DNP_476968.1 PTZ00184 6..153 CDD:185504
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.