DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Rnf148 and SPBP4H10.07

DIOPT Version :9

Sequence 1:	NP_082030.1	Gene:	Rnf148 / 71300	MGIID:	1918550	Length:	316	Species:	Mus musculus
Sequence 2:	NP_596181.1	Gene:	SPBP4H10.07 / 2541304	PomBaseID:	SPBP4H10.07	Length:	583	Species:	Schizosaccharomyces pombe

Alignment Length:	47	Identity:	19/47 - (40%)
Similarity:	29/47 - (61%)	Gaps:	2/47 - (4%)

- Green bases have known domain annotations that are detailed below.

Mouse   266 EDSCVVCFDMYKAQDVIRIL-TCKHFFHKTCIDPWLL-AHRTCPMCK 310
            ::.|:||...::..|..|.| .|.||||:.|||.||. :..:||:|:
pombe   522 DERCLVCLSNFELNDECRRLKQCNHFFHRECIDQWLTSSQNSCPLCR 568

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Rnf148	NP_082030.1	PA_GRAIL_like	56..190	CDD:239037
Rnf148	NP_082030.1	zf-RING_2	267..310	CDD:290367	18/44 (41%)
SPBP4H10.07	NP_596181.1	PHA03328	77..>156	CDD:223046
		zf-rbx1	<522..568	CDD:289448	18/45 (40%)
		RING	525..570	CDD:238093	19/44 (43%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	1	1.030	-	avgDist	Average_Evolutionary_Distance	R1977
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	2	1.940