powered by:
Protein Alignment TNFAIP6 and CG15253
DIOPT Version :9
Sequence 1: | NP_009046.2 |
Gene: | TNFAIP6 / 7130 |
HGNCID: | 11898 |
Length: | 277 |
Species: | Homo sapiens |
Sequence 2: | NP_609758.1 |
Gene: | CG15253 / 34916 |
FlyBaseID: | FBgn0028948 |
Length: | 253 |
Species: | Drosophila melanogaster |
Alignment Length: | 67 |
Identity: | 15/67 - (22%) |
Similarity: | 27/67 - (40%) |
Gaps: | 20/67 - (29%) |
- Green bases have known domain annotations that are detailed below.
Human 160 ICYWHIRLKYGQRIHLSFL--DFDLEDDPGCLADYVEIYDSYDDVHGFVGRYCGDELPDDIISTG 222
:||:.|.|.....:::::. ...:|.||...|.|:| ||.:|.. |:.
Fly 1 MCYYSILLLLLVVVNVAWAAPSIRIETDPELTAGYIE----------------GDMVPSG--SSR 47
Human 223 NV 224
|:
Fly 48 NI 49
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG3714 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.