DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TNFAIP6 and CG15253

DIOPT Version :9

Sequence 1:NP_009046.2 Gene:TNFAIP6 / 7130 HGNCID:11898 Length:277 Species:Homo sapiens
Sequence 2:NP_609758.1 Gene:CG15253 / 34916 FlyBaseID:FBgn0028948 Length:253 Species:Drosophila melanogaster


Alignment Length:67 Identity:15/67 - (22%)
Similarity:27/67 - (40%) Gaps:20/67 - (29%)


- Green bases have known domain annotations that are detailed below.


Human   160 ICYWHIRLKYGQRIHLSFL--DFDLEDDPGCLADYVEIYDSYDDVHGFVGRYCGDELPDDIISTG 222
            :||:.|.|.....:::::.  ...:|.||...|.|:|                ||.:|..  |:.
  Fly     1 MCYYSILLLLLVVVNVAWAAPSIRIETDPELTAGYIE----------------GDMVPSG--SSR 47

Human   223 NV 224
            |:
  Fly    48 NI 49

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TNFAIP6NP_009046.2 Link_domain_TSG_6_like 36..128 CDD:239592
CUB 135..244 CDD:278839 15/67 (22%)
CG15253NP_609758.1 Astacin 55..250 CDD:279708
ZnMc_astacin_like 59..246 CDD:239807
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.