DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TNFAIP6 and tnfaip6

DIOPT Version :10

Sequence 1:NP_009046.2 Gene:TNFAIP6 / 7130 HGNCID:11898 Length:277 Species:Homo sapiens
Sequence 2:XP_002936705.2 Gene:tnfaip6 / 100490996 XenbaseID:XB-GENE-988687 Length:269 Species:Xenopus tropicalis


Alignment Length:41 Identity:15/41 - (36%)
Similarity:21/41 - (51%) Gaps:10/41 - (24%)


- Green bases have known domain annotations that are detailed below.


Human   127 KKRGSLR--RPARTSVSQ-------VPRNSSPA-ESRTWHR 157
            ::..||:  |..|.|.||       :||.|:.| :|||..|
 Frog    37 RRSDSLKESRHRRFSYSQSKSRSKSLPRRSTSARQSRTPRR 77

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity