DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TSPAN6 and Tsp29Fa

DIOPT Version :9

Sequence 1:NP_003261.1 Gene:TSPAN6 / 7105 HGNCID:11858 Length:245 Species:Homo sapiens
Sequence 2:NP_001162915.1 Gene:Tsp29Fa / 34211 FlyBaseID:FBgn0032074 Length:248 Species:Drosophila melanogaster


Alignment Length:236 Identity:68/236 - (28%)
Similarity:109/236 - (46%) Gaps:25/236 - (10%)


- Green bases have known domain annotations that are detailed below.


Human    18 KSVLLIYTFIFWITGVILLAVGIWGKVSLENYFSLLNEKATNVPFVLIATGTVIILLGTFGCFAT 82
            |..|..:..||.|||:||:|||.........|...|..|..::|..||..|:.||::..|||:..
  Fly    12 KYTLFGFNLIFLITGIILIAVGAGVGAVYTGYKLFLAGKFFSIPTFLIVIGSFIIIISFFGCWGA 76

Human    83 CRASAWMLKLYAMFLTLVFLVELVAAIVGFVFRHEIKNSFKNNYEKALKQYNSTGDYRSHAV-DK 146
            .:.:..::..:::.|.::|::||.|.|.|:|.|::..:..|.:...:|.:|||.....:..: |.
  Fly    77 LKENYCLVLSFSVMLAIIFILELAAGISGYVLRNDASDLIKTSLTYSLNEYNSINPNATTKLWDD 141

Human   147 IQNTLHCCGVTDYRDWTDTNYYSEKGFPKSCCKLE-------DCTPQRD--ADKVNNEGC----- 197
            ||:...|||||.|.||...  :.....|.|||.:.       .|...:.  ||: :..||     
  Fly   142 IQDEFECCGVTSYNDWITA--FPNGDLPISCCNVHVGAVGTFTCNNAQSSVADR-HKVGCLDGFS 203

Human   198 -FIKVMTIIESEMGVVAGISFGVACFQLIGIFLAYCLSRAI 237
             :|....:.....|||      :|..|..|:..|..::|.|
  Fly   204 GYISAHAVSLGAAGVV------IAILQFFGVIFACYIAREI 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TSPAN6NP_003261.1 Tetraspannin 17..236 CDD:306775 66/233 (28%)
Tsp29FaNP_001162915.1 Tetraspannin 11..238 CDD:278750 67/234 (29%)
tetraspanin_LEL 106..210 CDD:239401 28/106 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1145558at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
43.780

Return to query results.
Submit another query.