DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TSPAN8 and Tsp39D

DIOPT Version :9

Sequence 1:NP_001356689.1 Gene:TSPAN8 / 7103 HGNCID:11855 Length:237 Species:Homo sapiens
Sequence 2:NP_523612.3 Gene:Tsp39D / 35405 FlyBaseID:FBgn0032943 Length:235 Species:Drosophila melanogaster


Alignment Length:235 Identity:69/235 - (29%)
Similarity:122/235 - (51%) Gaps:17/235 - (7%)


- Green bases have known domain annotations that are detailed below.


Human     2 AGVSACIKYSMFTFNFLFWLCGILILALAIWVRVSNDSQAIFGSEDVGSSSYVAVDILIAVGAII 66
            :|...|:||..|..|.||.|.|:||..:...|:::....:.|.|:.|    :.|..||:.|||.:
  Fly     3 SGGLTCVKYLTFFCNLLFALTGLLIFLVGGMVQLNYAHYSNFVSDHV----WTAPIILMIVGAAV 63

Human    67 MILGFLGCCGAIKESRCMLLLFFIGLLLILLLQVATGILGAVFKSKSDRIVNETLYENTKLLSAT 131
            .::.|||||||:|||.||:|.|.:..::|.|.::..|:.|.|..:...:|: |:.:.:|   ...
  Fly    64 AVICFLGCCGALKESSCMILSFALLAVVIFLFEIGLGLAGYVKHTGLHQIM-ESQFNST---MQH 124

Human   132 GESEKQFQEAIIVFQEEFKCCGLVNGAADWGNNFQHYPELCAC-----LDKQRPCQSYNGKQVYK 191
            .:....:::|..:.|.|..||| :||..||...:::.....||     |.:.:.|.:.:..|   
  Fly   125 YKERADYRDAWTLLQTELDCCG-INGPNDWETVYRNSTLPAACCSVINLSEAKECTNTHATQ--- 185

Human   192 ETCISFIKDFLAKNLIIVIGISFGLAVIEILGLVFSMVLY 231
            ..|:..:.:.|....:|:..:..|:|.|::|.::|:..||
  Fly   186 HGCLQKLLEILDSKTLILASVVLGVAGIQMLTILFACCLY 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TSPAN8NP_001356689.1 Tetraspannin 8..230 CDD:334016 65/226 (29%)
TM4SF3_like_LEL 106..206 CDD:239407 22/104 (21%)
Tsp39DNP_523612.3 Tetraspannin 8..227 CDD:278750 68/230 (30%)
tetraspanin_LEL 104..200 CDD:239401 21/103 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.