DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TSPAN8 and Tsp29Fa

DIOPT Version :9

Sequence 1:NP_001356689.1 Gene:TSPAN8 / 7103 HGNCID:11855 Length:237 Species:Homo sapiens
Sequence 2:NP_001162915.1 Gene:Tsp29Fa / 34211 FlyBaseID:FBgn0032074 Length:248 Species:Drosophila melanogaster


Alignment Length:252 Identity:61/252 - (24%)
Similarity:115/252 - (45%) Gaps:33/252 - (13%)


- Green bases have known domain annotations that are detailed below.


Human     1 MAGVSACIKYSMFTFNFLFWLCGILILALAIWVRVSNDSQAIFGSEDVGSSSYVAVDILIAVGAI 65
            :.|.:..:||::|.||.:|.:.||:::|:...|........:|    :....:.....||.:|:.
  Fly     4 LTGSANAVKYTLFGFNLIFLITGIILIAVGAGVGAVYTGYKLF----LAGKFFSIPTFLIVIGSF 64

Human    66 IMILGFLGCCGAIKESRCMLLLFFIGLLLILLLQVATGILGAVFKS-KSDRIVNETLYENTKLLS 129
            |:|:.|.||.||:||:.|::|.|.:.|.:|.:|::|.||.|.|.:: .||.|.....|...:..|
  Fly    65 IIIISFFGCWGALKENYCLVLSFSVMLAIIFILELAAGISGYVLRNDASDLIKTSLTYSLNEYNS 129

Human   130 ATGESEKQFQEAIIVFQEEFKCCGLVNGAADWGNNFQHYPELCACLDKQRPCQSYNG-------- 186
            ....:..:..:.|   |:||:||| |....||...|.:.....:|      |..:.|        
  Fly   130 INPNATTKLWDDI---QDEFECCG-VTSYNDWITAFPNGDLPISC------CNVHVGAVGTFTCN 184

Human   187 ------KQVYKETCISFIKDFLAKNLIIVIGISFGLAVIEILGLVFSMVLYCQIGNK 237
                  ...:|..|:.....:::.:.:.:......:|:::..|::|:    |.|..:
  Fly   185 NAQSSVADRHKVGCLDGFSGYISAHAVSLGAAGVVIAILQFFGVIFA----CYIARE 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TSPAN8NP_001356689.1 Tetraspannin 8..230 CDD:334016 58/236 (25%)
TM4SF3_like_LEL 106..206 CDD:239407 23/114 (20%)
Tsp29FaNP_001162915.1 Tetraspannin 11..238 CDD:278750 60/245 (24%)
tetraspanin_LEL 106..210 CDD:239401 22/113 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.