DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TSPAN8 and Tsp5D

DIOPT Version :9

Sequence 1:NP_001356689.1 Gene:TSPAN8 / 7103 HGNCID:11855 Length:237 Species:Homo sapiens
Sequence 2:NP_001259266.1 Gene:Tsp5D / 31540 FlyBaseID:FBgn0029837 Length:287 Species:Drosophila melanogaster


Alignment Length:260 Identity:64/260 - (24%)
Similarity:117/260 - (45%) Gaps:37/260 - (14%)


- Green bases have known domain annotations that are detailed below.


Human     7 CIKYSMFTFNFLFWLCGILILALAIWVRVSNDSQAIFGSEDVGSSSYVAVDILIAVGAIIMILGF 71
            ||:.:....|.:.|||....|...:|:|:|....|....:..|.|   |..|.:.:|....::.|
  Fly     8 CIRRTFCWLNIILWLCSCAFLGAGLWLRLSYAGYATLLPQHAGLS---ADTIFMGIGGTGFVVSF 69

Human    72 LGCCGAIKESRCMLLLFFIGLLLILLLQVATGILGAVFKSKSDRIVNETL-------YENTKLLS 129
            .|||||..:|||:|:|:|:.::::.:.:...|.:..:|:....|.:...|       |.::...|
  Fly    70 FGCCGAWVQSRCLLVLYFMLIVMLFMSEFLVGSIAFLFRGGLGRTLANELRFGIERHYNSSDRGS 134

Human   130 ATGESEKQFQEAIIVFQEEFKCCGLVNGAADWGNNFQHYP-------ELCACLDKQR-------- 179
            ....|.....:::   |:.|:||| |:...|| .:.|.:|       ..|..|..||        
  Fly   135 LVAPSVASIWDSV---QQSFECCG-VSSYEDW-YDIQSWPGRRWVPESCCRTLYDQRQVLTEGSG 194

Human   180 ------PC-QSYNGKQVYKETCISFIKDFLAKNLIIVIGISFGLAVIEILGLVFSMVLYCQIGNK 237
                  .| :|.|....:.:.|...::.:....|.:|..:..|:|.:::.||:.||:|:|.:.:|
  Fly   195 DGMMRPDCGRSENPSLWWDKGCAHSLQSWFTGQLNVVGAVGLGIAFVQLFGLITSMLLFCTVKHK 259

Human   238  237
              Fly   260  259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TSPAN8NP_001356689.1 Tetraspannin 8..230 CDD:334016 60/250 (24%)
TM4SF3_like_LEL 106..206 CDD:239407 24/128 (19%)
Tsp5DNP_001259266.1 Tetraspannin 8..256 CDD:278750 63/255 (25%)
NET-5_like_LEL 105..228 CDD:239418 24/127 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X124
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.