DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NR2E1 and kni

DIOPT Version :10

Sequence 1:NP_001273031.1 Gene:NR2E1 / 7101 HGNCID:7973 Length:422 Species:Homo sapiens
Sequence 2:NP_001287130.1 Gene:kni / 40287 FlyBaseID:FBgn0001320 Length:434 Species:Drosophila melanogaster


Alignment Length:88 Identity:21/88 - (23%)
Similarity:35/88 - (39%) Gaps:21/88 - (23%)


- Green bases have known domain annotations that are detailed below.


Human   704 RRQQQQQQEEQKRRQEEEELFRRKQVRQQELLLKLLQQQQATNVPVPP--APSSPPPLWAGLAKQ 766
            ||::...|.::.|..:    .:.|:....:|..||:.::..|.:|:..  |..|...||..|.| 
  Fly     2 RRRRCDLQPKRTRMCD----LQPKRTSMCDLPPKLVGEKILTRIPITSLRAVRSTCKLWNALTK- 61

Human   767 GLSMKTLLELQMESERQLHKQAA 789
                          :|.|.|.||
  Fly    62 --------------DRVLGKAAA 70

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NR2E1NP_001273031.1 NR_DBD_TLX 45..136 CDD:143537
NR_LBD_Tlx_PNR_like 191..406 CDD:132748
kniNP_001287130.1 NR_DBD_like 8..92 CDD:413390 19/82 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.