DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SERPING1 and Spn88Eb

DIOPT Version :9

Sequence 1:NP_000053.2 Gene:SERPING1 / 710 HGNCID:1228 Length:500 Species:Homo sapiens
Sequence 2:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster


Alignment Length:402 Identity:98/402 - (24%)
Similarity:177/402 - (44%) Gaps:69/402 - (17%)


- Green bases have known domain annotations that are detailed below.


Human   148 DFSLKLYHAFSAMKKVET-----NMAFSPFSIASLLTQVLLGAGENTKTNLESILSYPKDFTCVH 207
            ||||.|      ||::..     |:.|||||..:.|......:.|.|:..|...|:...... ..
  Fly    40 DFSLAL------MKQIREIYPSGNLFFSPFSTYNALLLAYFSSSEQTERELAQALNLGWALN-KQ 97

Human   208 QALKGFT-------------TKGVTSVSQIFHSPDLAIRDTFVNASRTLYSSSPRV-LSNNSDAN 258
            |.|..:|             ...::|.::||....:.:.:.|   :..||.::..: ..|:.:..
  Fly    98 QVLVSYTLAQRQDEFRWRQSPMELSSANRIFVDRTINVSNKF---NTLLYGATKELDFKNDPETG 159

Human   259 LELINTWVAKNTNNKISRLLDS--LPSDTRLVLLNAIYLSAKWKTTFDPKKTRMEPFHFKNSVIK 321
            |:.||.|:|..|:|:|..:|.|  :...|.|||.||.|:..:|.:.|..::|.::||.......:
  Fly   160 LKEINDWIADKTHNQIRDMLSSEEITPHTMLVLANAAYMKGQWLSQFKVEETALKPFFINEREQE 224

Human   322 VPMMNSKKYPVAHFIDQTLKAKVGQL----------------QLSHNLSLVILVPQNLKHRLEDM 370
            :..|..|.......||:.|::::.:|                :...::|::|::|.:.|..|..:
  Fly   225 MVYMMHKTGAFKMTIDEGLQSQIIKLPYRTIYKSKETHISTPESKSDISMIIILPNSNKISLNRV 289

Human   371 EQALSPSVFK-----AIMEKLEMS--KFQPTLLTLPRIKVTTSQDMLSIMEKLEFFDFSYDLNLC 428
            ...|:....|     |:.:|:|:|  |||    ...|:::|....::.:...     |:.:....
  Fly   290 ISRLNADSVKKWFERALPQKIELSLPKFQ----FEQRLELTPILSLMGVNTM-----FTRNATFG 345

Human   429 GLTEDP-DLQVSAMQHQTVLELTETGVEAAAASAISVARTL-----LVFEVQQPFLFVLWDQQHK 487
            .||.|| .|.:...||...:::.|.|..||||:.:.|:|:.     ..|....||:|:::|::..
  Fly   346 DLTADPISLVIDDAQHLAKIKVDEVGSTAAAATILLVSRSSRQPDPTKFNCNHPFVFLIYDEKVD 410

Human   488 FPVFMGRVYDPR 499
            ..:|.|...|||
  Fly   411 TILFAGVYSDPR 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SERPING1NP_000053.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 20..43
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 65..118
7 X 4 AA tandem repeats of [QE]-P-T-[TQ] 85..119
C1_inh 145..495 CDD:239005 95/396 (24%)
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 95/396 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.