DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACTG1 and Arp10

DIOPT Version :9

Sequence 1:NP_001186883.1 Gene:ACTG1 / 71 HGNCID:144 Length:375 Species:Homo sapiens
Sequence 2:NP_001285452.1 Gene:Arp10 / 32969 FlyBaseID:FBgn0031050 Length:378 Species:Drosophila melanogaster


Alignment Length:390 Identity:84/390 - (21%)
Similarity:157/390 - (40%) Gaps:64/390 - (16%)


- Green bases have known domain annotations that are detailed below.


Human     3 EEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTL 67
            :|...:|:|.|:...|.|||.:..||.:.|:.|       ||...|.:          ||     
  Fly     9 QEKPPIVLDIGTAYTKLGFAAEAYPRKIMPTEV-------VMTTTGIR----------KR----- 51

Human    68 KYPIEHGIVTNWDDMEKIWHH-------TFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFE 125
                    :.::|..|:::..       .|:..|.|:|:|...:|.|........||.:.:::|.
  Fly    52 --------LFDYDTPEELYDQLVDFLQTIFFKHLLVSPKERKFVLVENVFGSTVLRETLARVLFV 108

Human   126 TFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLM 190
            .|:..::......:::|......|.:|:|.|...|..:|::.|..:..|.......|..:...:.
  Fly   109 HFDVSSVLFVPVHLIALSTLAVPTALVVDVGYSETSVMPVFSGVQIMAAFKDQSYGGSAIHAEIK 173

Human   191 KILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNE-- 253
            :.|.|.|...:...| .::.|||.:.|:|.   ..|.|.|.::....:....||...|...|:  
  Fly   174 RQLVESGVKESLLTE-SVLEDIKVRTCFVT---TMERAKARANGDENQPTPAPDVDYIVSDNDAV 234

Human   254 -------RFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIAD 311
                   |....|.:|:.|   .|...:......||:.|.:|:|:.|..:..|.||.:|..|:..
  Fly   235 IQVPGLLRESAYEIMFEAS---NERDSLPHLILRSILDCTLDVRRALVESVFLVGGGSMVQGLLA 296

Human   312 RMQKEITALAP----------STMKIKII-APPERKYSVWIGGSILASLSTFQQMWISKQEYDES 365
            |:::|:..|..          ..::.|.. |..::.::.|:||::..:....|...:.|:.|.:|
  Fly   297 RLRQELQHLLTEDPFYAERFHGELQFKFFNAVGKQNFTAWLGGALCGATDLIQTRSLVKETYLKS 361

Human   366  365
              Fly   362  361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACTG1NP_001186883.1 PTZ00281 1..375 CDD:173506 84/390 (22%)
Arp10NP_001285452.1 ACTIN 11..340 CDD:214592 78/365 (21%)
NBD_sugar-kinase_HSP70_actin 12..367 CDD:302596 83/387 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.