DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TLR3 and lbk

DIOPT Version :10

Sequence 1:NP_003256.1 Gene:TLR3 / 7098 HGNCID:11849 Length:904 Species:Homo sapiens
Sequence 2:NP_611091.2 Gene:lbk / 36788 FlyBaseID:FBgn0034083 Length:1252 Species:Drosophila melanogaster


Alignment Length:681 Identity:161/681 - (23%)
Similarity:237/681 - (34%) Gaps:243/681 - (35%)


- Green bases have known domain annotations that are detailed below.


Human    28 CTVSHEVADCSHLKLTQVPDDLPTNITVLNLTHNQLRRLPAANFTRYSQLTSLDVGFNTISKLEP 92
            |...:.:.||..|.|.:|| .||:.:..|:|.:|:|.............||.:.:..|.:     
  Fly   269 CKCLNVLFDCDKLHLERVP-VLPSYVQTLHLANNKLNDTTVLEIRNLLNLTKVSLKRNLL----- 327

Human    93 ELCQK---LPMLKVLNLQHNELSQLSDKTFAFCTNLTELHLMSNSIQKIKNNPFVKQKNLITLDL 154
            |:..|   |..||.|.|.:|.::.:|.::.|....|..|.|..|.:..|:.|.|.|..||:.|.|
  Fly   328 EVIPKFIGLSGLKHLVLANNHITSISSESLAALPLLRTLDLSRNKLHTIELNSFPKSNNLVHLIL 392

Human   155 SHNGLSSTKLGTQVQLENLQELLLSNNKIQALKSEELDIFAN-SSLKKLELSSNQIKEFSPGCFH 218
            |.|.:::....:...|.||.:|.||||::..|   .:.:|.| :.||||.|:.||::        
  Fly   393 SFNEITNVNEHSFATLNNLTDLELSNNRLSTL---PIRVFKNLNQLKKLALNFNQLE-------- 446

Human   219 AIGRLFGLFLNNVQLGPSLTEKLCLELANTSIRNLSLSNSQLSTTSNTTFLGLKWTNLTMLDLSY 283
                                       .|.|                 ||.||:  ::..|.|..
  Fly   447 ---------------------------INWS-----------------TFRGLE--SMKNLQLKS 465

Human   284 NNLNVVGNDSFAWLPQLEYFFLEYNNIQHLFSHSLHGLFNVRYLNLKRSFTKQSISLASLPKIDD 348
            |.:..:.:..|..:.::|...|..|.|..|   |..||||:         ||             
  Fly   466 NKIRALQDGVFYVMHKIETIDLAMNQISSL---SRQGLFNL---------TK------------- 505

Human   349 FSFQWLKCLEHLNMEDNDIPGIKSNMFTGLINLKYLSLSNSFTSLRTLTNETFVSLAHSPLHILN 413
                    |.|||:                          ||                       
  Fly   506 --------LRHLNL--------------------------SF----------------------- 513

Human   414 LTKNKISKIESDAFSWLGHLEVLDLGLNEIGQELTGQEWRGLENIFEIYLSYNKYLQLTRNSFAL 478
               |.||:||.|.:.:...||||||..|.| .|...|....|..:..:.|::|:...|..|:|..
  Fly   514 ---NAISRIEVDTWEFTQSLEVLDLSNNAI-NEFKPQHLDCLHRLKTLNLAHNRLQYLQENTFDC 574

Human   479 VPSLQRLMLRRVALKNV---DSSPSPFQPLRNLTILDLSNNNIANINDDMLEGLEKLEILDLQHN 540
            |.:|:.|.|||..|..:   .|:.:||:.||.|..|||..||:..|:...:.||..||       
  Fly   575 VKNLEELNLRRNRLSWIIEDQSAAAPFKGLRKLRRLDLHGNNLKQISTKAMSGLNNLE------- 632

Human   541 NLARLWKHANPGGPIYFLKGLSHLHILNLESNGFDEIPVEVFKDLFELKIIDLGLNNLNTLPASV 605
                                     ||||.||....|.|..|:.:..|                 
  Fly   633 -------------------------ILNLGSNALASIQVNAFEHMLRL----------------- 655

Human   606 FNNQVSLKSLNLQKNLITSVEKKVFGPAFRNLTELDMRFNPFDCTCESIAWFVNWINETHTNIPE 670
              |::..||||                              |.|.|: :.||..|:.   ...|:
  Fly   656 --NKLVFKSLN------------------------------FICDCD-LVWFQQWLK---NRFPQ 684

Human   671 LSSHYLCNTPPHYHGFPVRLFDTSS--CKDS 699
            .:.|.:|..|.|.....::...:|.  |.||
  Fly   685 QAEHAVCGYPEHLLDRHLKSLSSSELVCVDS 715

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TLR3NP_003256.1 leucine-rich repeat 33..52 CDD:275380 8/18 (44%)
LRR <36..309 CDD:443914 69/276 (25%)
LRR 1 52..73 4/20 (20%)
leucine-rich repeat 53..76 CDD:275380 4/22 (18%)
LRR 2 76..97 4/20 (20%)
leucine-rich repeat 77..100 CDD:275380 6/25 (24%)
LRR 3 100..121 6/20 (30%)
leucine-rich repeat 101..124 CDD:275380 7/22 (32%)
LRR 4 124..145 7/20 (35%)
leucine-rich repeat 125..148 CDD:275380 8/22 (36%)
LRR 5 148..168 6/19 (32%)
leucine-rich repeat 149..198 CDD:275380 16/49 (33%)
LRR 6 172..193 8/20 (40%)
LRR 7 198..219 7/20 (35%)
leucine-rich repeat 199..249 CDD:275380 8/49 (16%)
LRR 8 222..244 0/21 (0%)
LRR 9 249..270 3/20 (15%)
leucine-rich repeat 250..275 CDD:275380 4/24 (17%)
LRR 10 275..296 4/20 (20%)
leucine-rich repeat 276..299 CDD:275380 4/22 (18%)
LRR 284..>630 CDD:443914 80/348 (23%)
LRR 11 299..320 6/20 (30%)
leucine-rich repeat 300..321 CDD:275380 6/20 (30%)
LRR 12 323..344 3/20 (15%)
LRR 13 356..377 4/20 (20%)
leucine-rich repeat 357..380 CDD:275380 4/22 (18%)
LRR 14 380..400 2/19 (11%)
leucine-rich repeat 381..406 CDD:275380 2/24 (8%)
LRR 15 408..429 6/20 (30%)
leucine-rich repeat 409..432 CDD:275380 6/22 (27%)
LRR 16 432..454 10/21 (48%)
leucine-rich repeat 433..457 CDD:275380 11/23 (48%)
leucine-rich repeat 458..481 CDD:275380 6/22 (27%)
LRR 17 465..486 6/20 (30%)
leucine-rich repeat 482..507 CDD:275380 10/27 (37%)
LRR 18 507..528 7/20 (35%)
leucine-rich repeat 508..531 CDD:275380 9/22 (41%)
LRR 19 531..552 2/20 (10%)
leucine-rich repeat 532..563 CDD:275380 2/30 (7%)
LRR 20 563..584 9/20 (45%)
leucine-rich repeat 564..585 CDD:275380 9/20 (45%)
LRR 21 587..608 1/20 (5%)
leucine-rich repeat 588..611 CDD:275380 2/22 (9%)
LRR 22 611..632 4/20 (20%)
leucine-rich repeat 612..630 CDD:275380 4/17 (24%)
leucine-rich repeat 637..659 CDD:275380 5/21 (24%)
LRRCT 645..697 CDD:214507 12/53 (23%)
Tlr3_TMD 698..730 CDD:465595 2/2 (100%)
TIR 755..900 CDD:214587
lbkNP_611091.2 LRR <293..642 CDD:443914 128/528 (24%)
leucine-rich repeat 293..316 CDD:275380 4/22 (18%)
leucine-rich repeat 317..338 CDD:275380 6/25 (24%)
leucine-rich repeat 339..362 CDD:275380 7/22 (32%)
leucine-rich repeat 363..386 CDD:275380 8/22 (36%)
leucine-rich repeat 387..410 CDD:275380 6/22 (27%)
leucine-rich repeat 411..434 CDD:275380 9/25 (36%)
leucine-rich repeat 435..457 CDD:275380 13/75 (17%)
leucine-rich repeat 458..481 CDD:275380 4/22 (18%)
leucine-rich repeat 482..505 CDD:275380 10/34 (29%)
leucine-rich repeat 506..529 CDD:275380 12/74 (16%)
leucine-rich repeat 530..553 CDD:275380 11/23 (48%)
leucine-rich repeat 554..577 CDD:275380 6/22 (27%)
leucine-rich repeat 578..604 CDD:275380 9/25 (36%)
leucine-rich repeat 607..630 CDD:275380 9/22 (41%)
leucine-rich repeat 631..652 CDD:275380 11/52 (21%)
LRRCT 665..712 CDD:214507 12/50 (24%)
Ig_3 717..816 CDD:464046
Ig 835..924 CDD:472250
Ig strand B 851..855 CDD:409353
Ig strand C 864..868 CDD:409353
Ig strand E 890..894 CDD:409353
Ig strand F 904..909 CDD:409353
Ig strand G 917..920 CDD:409353
Ig_3 927..1013 CDD:464046
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.