DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TLR3 and rdo

DIOPT Version :10

Sequence 1:NP_003256.1 Gene:TLR3 / 7098 HGNCID:11849 Length:904 Species:Homo sapiens
Sequence 2:NP_001286024.1 Gene:rdo / 35077 FlyBaseID:FBgn0243486 Length:757 Species:Drosophila melanogaster


Alignment Length:595 Identity:149/595 - (25%)
Similarity:219/595 - (36%) Gaps:176/595 - (29%)


- Green bases have known domain annotations that are detailed below.


Human    26 TKCTVSHEVAD-----CSHLKLTQV--PDDLPTNITVLNLTHNQLRRLPAANFTRYSQLTSLDVG 83
            |:|..|.:..|     |:...|..:  |::|..::.|:      :.|.|.         .|:.:|
  Fly    26 TECQCSMDDLDRYQAICTKGGLNSLLSPNELDVDVKVI------IIRGPR---------NSITIG 75

Human    84 FNTISKLEPELCQKLPMLKVLNLQHNELSQLSDKTFAFCTNLTELHLMSNSIQKIKNNPFVKQKN 148
                    |.|.|.: .|::|.:..:.|..:..::|.....|..|.|..|:|..|..|.|..|.|
  Fly    76 --------PALRQFM-KLEILRITDSNLPAIGAESFWGLKYLRILDLSKNNITNITENNFRGQDN 131

Human   149 LITLDLSHNGLSSTKLGTQVQLENLQELLLSNNKIQALKSEELDIFANSSLKKLELSSNQIKEFS 213
            |:.||||.|.:......|...|.:|:.|.|::|.|..|  .:.:.|..|.||.|:||.|.:::..
  Fly   132 LLELDLSKNKVLRMASSTFRHLTDLRRLNLADNSIVEL--VQRNFFMLSRLKYLDLSGNPLQDLQ 194

Human   214 PGCFHAIGRLFGLFLNNVQLG----------PSLTEKLCLELANTSIRNLS-------------- 254
            |..|..:..|..|...|.||.          |.|:|   |:|.....:.|.              
  Fly   195 PDVFRDVPELKVLKCRNCQLKKINPQMYNLLPLLSE---LDLGRNEFKFLDKDEFRDVKRLTKVL 256

Human   255 LSNSQLSTTSNTTFLGLKWTNLTMLDLSYNNLNVVGNDSFAWLPQLEYFFLEYNNIQHLFSHSLH 319
            |..:|||...:..|...|  :|..||||||.|..|.||||..|..|.:..|.||.:..|...|:.
  Fly   257 LDGNQLSVVVDQLFRMQK--SLNHLDLSYNRLAKVPNDSFLQLTNLTFLDLSYNKLVRLEPQSIR 319

Human   320 GLFNVRYLNLKRSFTKQSISLASLPKIDDFSFQWLKCLEHLNMEDNDIPGIKSNMFTGLINLKYL 384
            .|.|:..||:.                                                      
  Fly   320 SLSNLLTLNIS------------------------------------------------------ 330

Human   385 SLSNSFTSLRTLTNETFVSLAHSPLHILNLTKNKISKIESDAFSWLGHLEVLDLGLNEIGQELTG 449
              .|....||.: .|||..|    ::...||   .||:.......|.||.:.|:|...:      
  Fly   331 --GNVLMDLREM-RETFEPL----IYYFFLT---CSKLFFQLIPQLTHLAIADMGTMPV------ 379

Human   450 QEWRGLENIFEIYLSYNKYLQLTRNSFALVPSLQRLMLRRVALKNVDSSPSPFQPLRNLTILDLS 514
                ||.:.|:    ..:||.::.||           |...||:.:|       |.|.|..||||
  Fly   380 ----GLLHPFK----QLRYLNISGNS-----------LNNTALEVID-------PCRELEFLDLS 418

Human   515 NNNIANINDDMLEGLEKLEILDLQHN-------------NLAR--LWKHANPGGPIYFL-KGLSH 563
            .|.:..|::|.:..::.:..:.|.:|             |:.|  .||...  .||.|| |.|..
  Fly   419 RNQLHGISEDTVLRIQGIRNVRLDNNPLICDECHMGKLINVVRQLQWKWDT--YPICFLPKSLRG 481

Human   564 LHILNLESNG 573
            ..|.||:.||
  Fly   482 AEINNLDING 491

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TLR3NP_003256.1 leucine-rich repeat 33..52 CDD:275380 5/25 (20%)
LRR <36..309 CDD:443914 85/303 (28%)
LRR 1 52..73 3/20 (15%)
leucine-rich repeat 53..76 CDD:275380 3/22 (14%)
LRR 2 76..97 4/20 (20%)
leucine-rich repeat 77..100 CDD:275380 5/22 (23%)
LRR 3 100..121 4/20 (20%)
leucine-rich repeat 101..124 CDD:275380 4/22 (18%)
LRR 4 124..145 8/20 (40%)
leucine-rich repeat 125..148 CDD:275380 9/22 (41%)
LRR 5 148..168 8/19 (42%)
leucine-rich repeat 149..198 CDD:275380 15/48 (31%)
LRR 6 172..193 6/20 (30%)
LRR 7 198..219 8/20 (40%)
leucine-rich repeat 199..249 CDD:275380 18/59 (31%)
LRR 8 222..244 8/31 (26%)
LRR 9 249..270 6/34 (18%)
leucine-rich repeat 250..275 CDD:275380 7/38 (18%)
LRR 10 275..296 13/20 (65%)
leucine-rich repeat 276..299 CDD:275380 14/22 (64%)
LRR 284..>630 CDD:443914 72/306 (24%)
LRR 11 299..320 6/20 (30%)
leucine-rich repeat 300..321 CDD:275380 6/20 (30%)
LRR 12 323..344 3/20 (15%)
LRR 13 356..377 0/20 (0%)
leucine-rich repeat 357..380 CDD:275380 0/22 (0%)
LRR 14 380..400 3/19 (16%)
leucine-rich repeat 381..406 CDD:275380 7/24 (29%)
LRR 15 408..429 4/20 (20%)
leucine-rich repeat 409..432 CDD:275380 5/22 (23%)
LRR 16 432..454 4/21 (19%)
leucine-rich repeat 433..457 CDD:275380 5/23 (22%)
leucine-rich repeat 458..481 CDD:275380 5/22 (23%)
LRR 17 465..486 4/20 (20%)
leucine-rich repeat 482..507 CDD:275380 5/24 (21%)
LRR 18 507..528 8/20 (40%)
leucine-rich repeat 508..531 CDD:275380 8/22 (36%)
LRR 19 531..552 6/35 (17%)
leucine-rich repeat 532..563 CDD:275380 12/46 (26%)
LRR 20 563..584 5/11 (45%)
leucine-rich repeat 564..585 CDD:275380 5/10 (50%)
LRR 21 587..608
leucine-rich repeat 588..611 CDD:275380
LRR 22 611..632
leucine-rich repeat 612..630 CDD:275380
leucine-rich repeat 637..659 CDD:275380
LRRCT 645..697 CDD:214507
Tlr3_TMD 698..730 CDD:465595
TIR 755..900 CDD:214587
rdoNP_001286024.1 LRR 69..>446 CDD:443914 123/497 (25%)
leucine-rich repeat 84..107 CDD:275380 4/22 (18%)
leucine-rich repeat 108..131 CDD:275380 9/22 (41%)
leucine-rich repeat 132..155 CDD:275380 8/22 (36%)
leucine-rich repeat 156..179 CDD:275380 7/24 (29%)
leucine-rich repeat 180..203 CDD:275380 8/22 (36%)
leucine-rich repeat 204..251 CDD:275380 11/49 (22%)
leucine-rich repeat 252..275 CDD:275380 6/24 (25%)
leucine-rich repeat 276..299 CDD:275380 14/22 (64%)
leucine-rich repeat 300..323 CDD:275380 7/22 (32%)
leucine-rich repeat 388..411 CDD:275380 9/40 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.