DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TLR1 and kek6

DIOPT Version :10

Sequence 1:NP_003254.2 Gene:TLR1 / 7096 HGNCID:11847 Length:786 Species:Homo sapiens
Sequence 2:NP_001263151.1 Gene:kek6 / 43729 FlyBaseID:FBgn0039862 Length:843 Species:Drosophila melanogaster


Alignment Length:341 Identity:76/341 - (22%)
Similarity:122/341 - (35%) Gaps:108/341 - (31%)


- Green bases have known domain annotations that are detailed below.


Human    36 LIHVPKDLSQKTTILNISQNYI-----SELWTSDILSLSK------------------LRILI-- 75
            |..:|..||.:..:|.::.|:|     .|..|..:|:|.:                  |:||:  
  Fly    60 LTTIPNTLSTELQVLVLNDNHIPYLNREEFSTLGLLNLQRIYLKKSEVQYIHKESFRNLKILVEI 124

Human    76 -ISHNRIQYLDISVFKFNQELEYLDLSHNKLVKISCHPTVNLKHL------DLSFNAFDALPICK 133
             :|.|:::.||...|..|..|..|.|:.|.|.:::.:....|.||      |...:..|.:.:  
  Fly   125 DLSDNKLEMLDKDTFMGNDRLRILYLNGNPLKRLAAYQFPILPHLRTLDMHDCLISYIDPMSL-- 187

Human   134 EFGNMSQLKFLGLSTTHLEKSSVLPIAHL-----------------------------NISKVLL 169
              .|::.|:||.|....||..|.....|:                             .:|.|.|
  Fly   188 --ANLNLLEFLNLKNNLLESLSEYVFQHMANLKTLSLEENPWQCNCKLRKFRGWYVNSRLSSVSL 250

Human   170 VL-------GETYGEKED-----PEGLQDFNTESL-HIVFPTNKEFHFILDVSVKTVANLELSNI 221
            |.       ..|:...:|     |..::.||.|.: :|...:|..|..::..........|| |.
  Fly   251 VCKGPPAQKDRTWDSVDDELFGCP
PRVEIFNNEEVQNIDIGSNTTFSCLVYGDPLPEVAWEL-NG 314

Human   222 KCVLEDNKCSYFLSILAKLQTNPKL-SNLTLNNIET-----------------TWNSFIRILQLV 268
            |.:..||......||     .:.|| ||||:.|:.:                 |.|..|.:.::|
  Fly   315 KILDNDNVLFESESI-----ASDKLWSNLTVFNVTSLDAGTYACTGSNSIGSMTQNISIYLSEIV 374

Human   269 WHT------TVWYFSI 278
            .|.      |.|||.:
  Fly   375 QHVLEKTPETFWYFGL 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TLR1NP_003254.2 LRR <29..>152 CDD:443914 35/147 (24%)
leucine-rich repeat 47..70 CDD:275378 7/27 (26%)
LRR 1 54..77 9/48 (19%)
leucine-rich repeat 71..94 CDD:275378 9/25 (36%)
LRR 2 78..101 7/22 (32%)
leucine-rich repeat 95..115 CDD:275378 5/19 (26%)
LRR 3 102..125 6/28 (21%)
leucine-rich repeat 116..140 CDD:275378 6/29 (21%)
LRR 4 126..150 6/23 (26%)
leucine-rich repeat 141..152 CDD:275378 4/10 (40%)
LRR 5 151..175 8/59 (14%)
LRR 6 176..199 6/28 (21%)
LRR 7 200..223 4/22 (18%)
LRR 215..>526 CDD:443914 24/88 (27%)
LRR 8 224..250 8/26 (31%)
LRR 9 251..278 10/49 (20%)
LRR 10 279..308 76/341 (22%)
LRR 11 309..337
Interaction with bacterial lipopeptide 313..316
LRR 12 338..361
leucine-rich repeat 352..373 CDD:275380
LRR 13 362..388
leucine-rich repeat 374..399 CDD:275380
LRR 14 389..414
leucine-rich repeat 400..424 CDD:275380
LRR 15 415..437
leucine-rich repeat 425..446 CDD:275380
LRR 16 438..457
leucine-rich repeat 447..469 CDD:275380
LRR 17 458..478
leucine-rich repeat 470..492 CDD:275380
LRR 18 479..500
leucine-rich repeat 494..515 CDD:275380
LRR 19 501..524
LRRCT 524..577 CDD:214507
TIR 636..779 CDD:214587
kek6NP_001263151.1 LRR <56..>226 CDD:443914 39/169 (23%)
leucine-rich repeat 71..96 CDD:275380 5/24 (21%)
LRR_8 96..155 CDD:404697 14/58 (24%)
leucine-rich repeat 97..120 CDD:275380 2/22 (9%)
leucine-rich repeat 121..144 CDD:275380 7/22 (32%)
leucine-rich repeat 145..168 CDD:275380 6/22 (27%)
leucine-rich repeat 169..216 CDD:275380 12/50 (24%)
LRRCT 225..274 CDD:214507 6/48 (13%)
Ig 286..360 CDD:472250 18/79 (23%)
Ig strand B 294..298 CDD:409353 1/3 (33%)
Ig strand C 307..310 CDD:409353 0/2 (0%)
Ig strand E 336..340 CDD:409353 3/3 (100%)
Ig strand F 350..355 CDD:409353 0/4 (0%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.