DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TLR1 and CG42346

DIOPT Version :10

Sequence 1:NP_003254.2 Gene:TLR1 / 7096 HGNCID:11847 Length:786 Species:Homo sapiens
Sequence 2:NP_001036303.2 Gene:CG42346 / 3355160 FlyBaseID:FBgn0259677 Length:1817 Species:Drosophila melanogaster


Alignment Length:711 Identity:145/711 - (20%)
Similarity:258/711 - (36%) Gaps:227/711 - (31%)


- Green bases have known domain annotations that are detailed below.


Human    23 EESEFLVDRSKNGLIHV--PKDLS--QKTTILNISQNYISELWTSDILSLSKLRILIISHNRIQY 83
            |.|..|..:.:...:|.  |:..|  ||..|:.:..|.::.:..|......:|..|.:|.|:|:.
  Fly   721 ENSSLLSVQLEANYLHKVHPRTFSRQQKVQIMWLKDNQLTRVERSFFADTPQLGRLYLSDNKIRD 785

Human    84 LDISVFKFNQELEYLDLSHNKLVKIS---CHPTVNLKHLDLSFNAFDALPICKEFGNMSQLKFLG 145
            ::...|.....|::||||.|:|.::.   ..|..:|:.|.|:.|..:|:. ...|..:..||.|.
  Fly   786 IEKDTFVNLLLLQFLDLSGNQLRQLRRDYFAPLQDLEELSLARNHIEAIE-GYAFAKLKNLKSLD 849

Human   146 LSTTHLEK------SSVLPIAHLNIS------------KVLLVLGETYGEKE--DPEGLQDFNTE 190
            ||...|.:      |:..|:..||:.            |.|..|.|...|:.  :|..:|..:..
  Fly   850 LSHNPLVQLTRDIFSNEFPLNSLNLGNCSLRKLEQHAFKSLTNLNELNLERNQLNPADIQTLDIP 914

Human   191 SLHIVFPTNKEFHFILDVSV--------KTVANLELSN-----------------IKCVLEDNKC 230
            :|..:..::..|.:...|.:        :::..|.:||                 ::..|.||:.
  Fly   915 NLRRLLLSHNNFSYAGSVGIMAGMLDRLRSLQQLSMSNCSLGQIPDLLFAKNTNLVRLDLCDNRL 979

Human   231 SYF-------LSILAKLQ-TNPKLS---NLTLNNIETTWNSFIRILQLVWHTTVWYFSISNVKLQ 284
            :..       |::..:|: ...:||   ::.|.|:.|..:..:...||.        ||...||.
  Fly   980 TQINRNIFSGLNVFKELRLCRNELSDFPHIALYNLSTLESLDLARNQLA--------SIDFFKLS 1036

Human   285 GQLDFRDF------------------------DYSGTSLKAL------------SIHQVVSDVFG 313
            |.|:.|..                        |.||..|.:|            .:|...:....
  Fly  1037 GTLNLRQLILRDNKITALSGFNAVNLTQLDSVDLSGNLLLSLPANFLRHSINLQKVHLSNNRFLQ 1101

Human   314 FPQSYIYEI----FSNMNI------KNFTVSGTRMVHM----LCPSKIS-----------PFLHL 353
            .|.|.:.::    .|.:|:      :.:||...|..::    :|.:.:|           ...||
  Fly  1102 IPSSALSDVSIPRLSWLNLTGNPINRIYTVKEERYPYLKELYICQTNLSILTSKDFEAFQALQHL 1166

Human   354 DFSNNLLT---DTVFENCGHLTELETLILQMNQLKELSK---------------------IAEMT 394
            ...||.:|   ...|::   ||.|.||.|.:|:|:.|.|                     :.|.:
  Fly  1167 HLVNNRITRISPGAFKS---LTNLLTLDLSVNELEMLPKERLQGLRLLRFLNISHNTLKDLEEFS 1228

Human   395 TQMKSLQQLDISQNSVSYDEKKGDCSWTKSLLSLNMSSN---ILTDTIFRCLPPRIKVLDLHSNK 456
            ..:..:|.||:|.|.:....||...: ...||.|.:..|   :|::..||.| .::.||||..|.
  Fly  1229 VDLLEMQTLDLSFNQLDRISKKTFRN-LHGLLELFLMGNRMTVLSNDAFRFL-RKLHVLDLRKNY 1291

Human   457 IKSIPKQVVKLEALQELNVAFNSLTDLPGCGSFSSLSVLIIDHNSVSHPSADFFQSCQKMRSIKA 521
            .:.:|     ||.|:.|..                                       .:|:::.
  Fly  1292 FELVP-----LEPLRPLET---------------------------------------NLRTLRL 1312

Human   522 GDNPFQCTCE---LGEFVKNIDQVSSEV--------------LEGWPDSY-KCDYPESYRG 564
            .:||..|:|:   |.|::::..:.|..:              |.|...:| :|::|...||
  Fly  1313 EENPLHCSCDAQKLWEWLRDHRKWSLSMGSGAGRGIGGLTGGLGGDSINYLRCEHPTELRG 1373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TLR1NP_003254.2 LRR <29..>152 CDD:443914 33/129 (26%)
leucine-rich repeat 47..70 CDD:275378 3/22 (14%)
LRR 1 54..77 4/22 (18%)
leucine-rich repeat 71..94 CDD:275378 6/22 (27%)
LRR 2 78..101 6/22 (27%)
leucine-rich repeat 95..115 CDD:275378 8/22 (36%)
LRR 3 102..125 6/25 (24%)
leucine-rich repeat 116..140 CDD:275378 6/23 (26%)
LRR 4 126..150 7/23 (30%)
leucine-rich repeat 141..152 CDD:275378 5/10 (50%)
LRR 5 151..175 9/41 (22%)
LRR 6 176..199 4/24 (17%)
LRR 7 200..223 5/47 (11%)
LRR 215..>526 CDD:443914 81/426 (19%)
LRR 8 224..250 7/36 (19%)
LRR 9 251..278 5/26 (19%)
LRR 10 279..308 11/64 (17%)
LRR 11 309..337 6/37 (16%)
Interaction with bacterial lipopeptide 313..316 0/2 (0%)
LRR 12 338..361 6/37 (16%)
leucine-rich repeat 352..373 CDD:275380 7/23 (30%)
LRR 13 362..388 9/25 (36%)
leucine-rich repeat 374..399 CDD:275380 9/45 (20%)
LRR 14 389..414 7/45 (16%)
leucine-rich repeat 400..424 CDD:275380 7/23 (30%)
LRR 15 415..437 7/24 (29%)
leucine-rich repeat 425..446 CDD:275380 8/23 (35%)
LRR 16 438..457 8/18 (44%)
leucine-rich repeat 447..469 CDD:275380 7/21 (33%)
LRR 17 458..478 5/19 (26%)
leucine-rich repeat 470..492 CDD:275380 2/21 (10%)
LRR 18 479..500 0/20 (0%)
leucine-rich repeat 494..515 CDD:275380 0/20 (0%)
LRR 19 501..524 1/22 (5%)
LRRCT 524..577 CDD:214507 14/59 (24%)
TIR 636..779 CDD:214587
CG42346NP_001036303.2 LRR <301..606 CDD:443914
leucine-rich repeat 303..325 CDD:275380
leucine-rich repeat 327..350 CDD:275380
leucine-rich repeat 351..461 CDD:275380
leucine-rich repeat 399..422 CDD:275380
leucine-rich repeat 462..485 CDD:275380
LRR 486..>736 CDD:443914 3/14 (21%)
leucine-rich repeat 486..509 CDD:275380
leucine-rich repeat 510..533 CDD:275380
leucine-rich repeat 534..556 CDD:275380
leucine-rich repeat 557..580 CDD:275380
leucine-rich repeat 581..604 CDD:275380
leucine-rich repeat 605..628 CDD:275380
PPP1R42 627..860 CDD:455733 37/139 (27%)
leucine-rich repeat 629..652 CDD:275380
leucine-rich repeat 653..676 CDD:275380
leucine-rich repeat 677..700 CDD:275380
leucine-rich repeat 701..748 CDD:275380 6/26 (23%)
leucine-rich repeat 725..736 CDD:275378 1/10 (10%)
leucine-rich repeat 749..772 CDD:275380 3/22 (14%)
leucine-rich repeat 773..793 CDD:275380 6/19 (32%)
leucine-rich repeat 821..844 CDD:275380 6/23 (26%)
leucine-rich repeat 845..868 CDD:275380 7/22 (32%)
LRR 869..1226 CDD:443914 65/367 (18%)
leucine-rich repeat 869..892 CDD:275380 4/22 (18%)
leucine-rich repeat 893..915 CDD:275380 5/21 (24%)
leucine-rich repeat 916..944 CDD:275380 3/27 (11%)
leucine-rich repeat 945..968 CDD:275380 3/22 (14%)
leucine-rich repeat 969..992 CDD:275380 4/22 (18%)
leucine-rich repeat 993..1014 CDD:275380 4/20 (20%)
leucine-rich repeat 1017..1040 CDD:275380 7/30 (23%)
leucine-rich repeat 1041..1064 CDD:275380 1/22 (5%)
leucine-rich repeat 1089..1114 CDD:275380 3/24 (13%)
leucine-rich repeat 1115..1162 CDD:275380 7/46 (15%)
PPP1R42 1155..1317 CDD:455733 44/210 (21%)
leucine-rich repeat 1163..1186 CDD:275380 7/25 (28%)
leucine-rich repeat 1187..1210 CDD:275380 8/22 (36%)
leucine-rich repeat 1211..1233 CDD:275380 1/21 (5%)
leucine-rich repeat 1234..1257 CDD:275380 7/23 (30%)
leucine-rich repeat 1258..1279 CDD:275380 7/20 (35%)
leucine-rich repeat 1282..1306 CDD:275380 10/67 (15%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.