DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TLL2 and CG6696

DIOPT Version :10

Sequence 1:NP_036597.1 Gene:TLL2 / 7093 HGNCID:11844 Length:1015 Species:Homo sapiens
Sequence 2:NP_573318.1 Gene:CG6696 / 32856 FlyBaseID:FBgn0030947 Length:324 Species:Drosophila melanogaster


Alignment Length:223 Identity:69/223 - (30%)
Similarity:113/223 - (50%) Gaps:32/223 - (14%)


- Green bases have known domain annotations that are detailed below.


Human   156 ERI-WPGGVIP-YVIGGNFTGSQRAIFKQAMRHWEKHTCVTF--IERTDEESFIVFSYRTCGCCS 216
            ||: ||...:| |:...:|..:|..:..:|.:.:...||:.|  .|:.|:. :::......||.|
  Fly   101 ERLTWPEAAVPFYIDPQDFNANQTMVILKAFKEYHDRTCIRFRPYEQGDKH-WLLIKGNYSGCWS 164

Human   217 YVGRRGGGPQAISIG-KNCDKFGIVAHELGHVVGFWHEHTRPDRDQHVTIIRENIQPGQEYNFLK 280
            .||||.|| |.:::. ..|...|:|.|||.|.:||:|:.:..:||::|.|..|||..|..:||.|
  Fly   165 SVGRRSGG-QVLNLNTPKCVTHGVVVHELLHALGFYHQQSATERDEYVKINWENILDGHAHNFNK 228

Human   281 MEAGEVSSLGETYDFDSIMHYARNTFSRGVFLDTILPRQDDNG---VRP-----TIGQRVRLSQG 337
            .....:::.|..||:.|:|||:...||:             ||   :.|     ::|||..||..
  Fly   229 YARTHITNFGVEYDYQSVMHYSSRAFSK-------------NGKATIEPLDPYASLGQRRGLSDK 280

Human   338 DIAQARKLYKCPACGETLQ---DTTGNF 362
            |:::..::|: ..|.|...   |..||:
  Fly   281 DVSKLNEMYE-QDCSEDYLLNFDRFGNY 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TLL2NP_036597.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 24..49
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 88..130
ZnMc_BMP1_TLD 150..349 CDD:239808 64/205 (31%)
CUB 351..460 CDD:395345 5/15 (33%)
CUB 464..573 CDD:395345
FXa_inhibition 580..616 CDD:464251
CUB 620..729 CDD:395345
FXa_inhibition 736..771 CDD:464251
CUB 776..885 CDD:395345
CUB 889..1002 CDD:395345
CG6696NP_573318.1 ZnMc_astacin_like 110..289 CDD:239807 59/193 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.