DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TK2 and Tk2

DIOPT Version :9

Sequence 1:NP_004605.4 Gene:TK2 / 7084 HGNCID:11831 Length:265 Species:Homo sapiens
Sequence 2:NP_001099636.1 Gene:Tk2 / 291824 RGDID:1309279 Length:270 Species:Rattus norvegicus


Alignment Length:270 Identity:216/270 - (80%)
Similarity:236/270 - (87%) Gaps:5/270 - (1%)


- Green bases have known domain annotations that are detailed below.


Human     1 MLLWPLRGWAARALRCFGPGSRGSPA---SGPGPRRVQRRAWPPDK--EQEKEKKSVICVEGNIA 60
            |||..||.||||:||..||||.|||.   ||.||....|||.||||  |::||||:|:|:|||||
  Rat     1 MLLRSLRSWAARSLRSMGPGSSGSPGSLDSGAGPLWAPRRACPPDKDREKDKEKKAVVCIEGNIA 65

Human    61 SGKTTCLEFFSNATDVEVLTEPVSKWRNVRGHNPLGLMYHDASRWGLTLQTYVQLTMLDRHTRPQ 125
            ||||||||||||.||||||.|||.|||||.|||||.||||:||||||||||||||||||:|||||
  Rat    66 SGKTTCLEFFSNTTDVEVLMEPVLKWRNVHGHNPLSLMYHNASRWGLTLQTYVQLTMLDQHTRPQ 130

Human   126 VSSVRLMERSIHSARYIFVENLYRSGKMPEVDYVVLSEWFDWILRNMDVSVDLIVYLRTNPETCY 190
            :|.||||||||:|||||||||||||||||||||.:||||||||::|:||||||||||||.||.||
  Rat   131 MSPVRLMERSIYSARYIFVENLYRSGKMPEVDYAILSEWFDWIIKNIDVSVDLIVYLRTTPEICY 195

Human   191 QRLKKRCREEEKVIPLEYLEAIHHLHEEWLIKGSLFPMAAPVLVIEADHHMERMLELFEQNRDRI 255
            ||||.||||||||||:|||.|||||:||||:.|||||.|||||||||||::|:|||||||||.||
  Rat   196 QRLKMRCREEEKVIPVEYLSAIHHLYEEWLVTGSLFPAAAPVLVIEADHNLEKMLELFEQNRARI 260

Human   256 LTPENRKHCP 265
            |||||.||.|
  Rat   261 LTPENWKHGP 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TK2NP_004605.4 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 20..47 17/31 (55%)
dNK 53..265 CDD:279974 180/211 (85%)
DTMP_kinase 53..238 CDD:161676 158/184 (86%)
Tk2NP_001099636.1 dNK 58..265 CDD:279974 176/206 (85%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C83680091
Domainoid 1 1.000 375 1.000 Domainoid score I11731
eggNOG 00.000 Not matched by this tool.
HGNC 1 1.500 - -
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H3392
Inparanoid 1 1.050 442 1.000 Inparanoid score I12623
NCBI 1 1.000 - -
OMA 1 1.010 - - QHG54257
OrthoDB 1 1.010 - - D1505356at2759
OrthoFinder 1 1.000 - - FOG0001503
OrthoInspector 1 1.000 - - oto141024
orthoMCL 1 0.900 - - OOG6_102194
Panther 1 1.100 - - LDO PTHR10513
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X6020
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1717.370

Return to query results.
Submit another query.