DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TIMP3 and Timp

DIOPT Version :10

Sequence 1:NP_000353.1 Gene:TIMP3 / 7078 HGNCID:11822 Length:211 Species:Homo sapiens
Sequence 2:NP_731461.1 Gene:Timp / 41248 FlyBaseID:FBgn0025879 Length:210 Species:Drosophila melanogaster


Alignment Length:208 Identity:58/208 - (27%)
Similarity:99/208 - (47%) Gaps:31/208 - (14%)


- Green bases have known domain annotations that are detailed below.


Human     5 LGLIVLLGSWSLGDWG--AEACTCSPSHPQDAFCNSDIVIRAKVVGKKLVKEGPFGTLVYTIKQM 67
            |||:.||.......:|  |:||:|.|||||..|..:|.|::.:|:.|....|.  |...|.:...
  Fly     7 LGLLTLLLVAVFAFYGRPADACSCMPSHPQTHFAQADYVVQLRVLRKSDTIEP--GRTTYKVHIK 69

Human    68 KMYRGFT---KMPHVQYIHTEASESLCGLKLEVNKYQYLLTGRVYDGKMYT-GLCNFVERWDQLT 128
            :.|:..:   :|.....:.|...:::||:.|::.|. |::.||     |.| .:|::.:.:.::|
  Fly    70 RTYKATSEARRMLRDGRLSTPQDDAMCGINLDLGKV-YIVAGR-----MPTLNICSYYKEYTRMT 128

Human   129 LSQRKGLNYRYHLGCNCKIKSCYYLPCFVTSKN---ECLWTDMLSNFGYPGYQSKHYACIRQK-- 188
            :::|.|.:..|....||.:..|:...|| ..:|   .|.|    |.||  ..::.:.||:..|  
  Fly   129 ITERHGFSGGYAKATNCTVTPCFGERCF-KGRNYADTCKW----SPFG--KCETNYSACMPHKVQ 186

Human   189 --GGY---CSWYR 196
              .|.   |.|.|
  Fly   187 TVNGVISRCRWRR 199

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
TIMP3NP_000353.1 NTR_TIMP 24..200 CDD:239640 50/187 (27%)
Involved in metalloproteinase-binding. /evidence=ECO:0000269|PubMed:18638486, ECO:0007744|PDB:3CKI 24..27 1/2 (50%)