DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TIMP2 and Timp

DIOPT Version :10

Sequence 1:NP_003246.1 Gene:TIMP2 / 7077 HGNCID:11821 Length:220 Species:Homo sapiens
Sequence 2:NP_731461.1 Gene:Timp / 41248 FlyBaseID:FBgn0025879 Length:210 Species:Drosophila melanogaster


Alignment Length:219 Identity:56/219 - (25%)
Similarity:94/219 - (42%) Gaps:43/219 - (19%)


- Green bases have known domain annotations that are detailed below.


Human     8 LRLALGLLLLATLL------RPADACSCSPVHPQQAFCNADVVIRAKAVSEKE-VDSGNDIYGNP 65
            ||..||||.|..:.      ||||||||.|.|||..|..||.|::.:.:.:.: ::.|...|...
  Fly     3 LRKHLGLLTLLLVAVFAFYGRPADACSCMPSHPQTHFAQADYVVQLRVLRKSDTIEPGRTTYKVH 67

Human    66 IKRIQYEIKQIKMFKGPEKDIEFIYTAPSSAVCGVSLDVGGKKEYLIAGKAEGDGKMHITLCDFI 130
            |||......:.:......:    :.|....|:||::||:|  |.|::||:..     .:.:|.:.
  Fly    68 IKRTYKATSEARRMLRDGR----LSTPQDDAMCGINLDLG--KVYIVAGRMP-----TLNICSYY 121

Human   131 VPWDTLSTTQKKSLNHRYQMGCECKITRCPMIPCY-------ISSPDECLWMDWVTEKNINGHQA 188
            ..:..::.|::...:..|     .|.|.|.:.||:       .:..|.|.|..:      ...:.
  Fly   122 KEYTRMTITERHGFSGGY-----AKATNCTVTPCFGERCFKGRNYADTCKWSPF------GKCET 175

Human   189 KFFAC----IKRSDG---SCAWYR 205
            .:.||    ::..:|   .|.|.|
  Fly   176 NYSACMPHKVQTVNGVISRCRWRR 199

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
TIMP2NP_003246.1 NTR_TIMP 27..209 CDD:239640 44/194 (23%)
Involved in metalloproteinase-binding. /evidence=ECO:0000269|PubMed:24073280, ECO:0007744|PDB:4ILW 27..30 2/2 (100%)