DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TIE1 and drpr

DIOPT Version :9

Sequence 1:NP_005415.1 Gene:TIE1 / 7075 HGNCID:11809 Length:1138 Species:Homo sapiens
Sequence 2:NP_001261276.1 Gene:drpr / 38218 FlyBaseID:FBgn0027594 Length:1042 Species:Drosophila melanogaster


Alignment Length:235 Identity:71/235 - (30%)
Similarity:100/235 - (42%) Gaps:41/235 - (17%)


- Green bases have known domain annotations that are detailed below.


Human   152 KQTDVIWKSNGSYFYTLDWHEAQDGR---FLLQLPNVQPPSSGIYSATYLEASPLGSAFFRLIVR 213
            :.||:.....|:...::.|..||..|   ||...||.:...:....|   :.||:.....     
  Fly   366 EHTDLCHPETGNCQCSIGWSSAQCTRPCTFLRYGPNCELTCNCKNGA---KCSPVNGTCL----- 422

Human   214 GCGAGRWGPGCTKEC-PG-----------CLHGGVCHDHDGECVCPPGFTGTRCEQACREGRFGQ 266
             |..|..||.|.:.| ||           |.:|..|....|:|:|..|:...:|::.|....|||
  Fly   423 -CAPGWRGPTCEESCEPGTFGQDCALRCDCQNGAKCEPETGQCLCTAGWKNIKCDRPCDLNHFGQ 486

Human   267 SCQEQCPGISGCRGLTFCLPDPYGCSCGSGWRGSQCQEACAPGHFGADCRLQCQC--QNGGTCDR 329
            .|.:.|    .|.....|.|....|:|.:||.|.:|:..|..|.||.||..:|||  .|...||.
  Fly   487 DCAKVC----DCHNNAACNPQNGSCTCAAGWTGERCERKCDTGKFGHDCAQKCQCDFNNSLACDA 547

Human   330 FSG-CVCPSGWHGVHCEKS----------DRIPQILNMAS 358
            .:| |||...|.|||||.:          |::.:.||.:|
  Fly   548 TNGRCVCKQDWGGVHCETNCRSGYYGENCDKVCRCLNNSS 587

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TIE1NP_005415.1 ig 129..210 CDD:278476 14/60 (23%)
EGF_CA 227..256 CDD:238011 10/40 (25%)
EGF_2 315..344 CDD:285248 14/31 (45%)
ig 356..441 CDD:278476 1/3 (33%)
fn3 452..536 CDD:278470
fn3 548..632 CDD:278470
FN3 644..736 CDD:238020
PTKc_Tie1 836..1132 CDD:270671
TyrKc 839..1107 CDD:197581
drprNP_001261276.1 EMI 27..92 CDD:284877
EGF_CA 274..319 CDD:304395
DSL <479..518 CDD:302925 14/42 (33%)
DSL <567..606 CDD:302925 4/21 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.