DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TIE1 and NimA

DIOPT Version :9

Sequence 1:NP_005415.1 Gene:TIE1 / 7075 HGNCID:11809 Length:1138 Species:Homo sapiens
Sequence 2:NP_001285918.1 Gene:NimA / 318930 FlyBaseID:FBgn0261514 Length:565 Species:Drosophila melanogaster


Alignment Length:549 Identity:123/549 - (22%)
Similarity:173/549 - (31%) Gaps:170/549 - (30%)


- Green bases have known domain annotations that are detailed below.


Human   176 GRFLLQLPNVQPPSSGIYSATYLEASPLGSAFFRLIVRGCGAG------RWGPG--CTKECPGCL 232
            |:.||.|..|.|..||..|...:..:          |:...||      ..|||  |.:|.|...
  Fly     8 GKLLLLLAMVLPLGSGQNSTLKINTN----------VKDIEAGVVALPSIQGPGNICIREEPYVE 62

Human   233 HGGV-------------CHDHDGECVC----------PPGFTGTRCEQACREGRFGQ------SC 268
            |..|             |.:....|..          ......||..:.|.:|..|.      :|
  Fly    63 HVQVPEMQPVRVRTSSWCMEIPPRCATFKTEMREVMRVQKLNKTRTVRFCCQGYEGNLSDSQATC 127

Human   269 QEQCPGISGCRGLTFCLPDPYGCSCGSGWRGSQCQEACAPGHFGADCRLQCQCQNGGTCDRFSG- 332
            :..|.|  ||...:..:||.  |||..|:.|..|.:.|....:|.||:..||||||..||..|| 
  Fly   128 KPICRG--GCGRGSCVMPDI--CSCEEGYIGKHCTQRCDHDRWGLDCKNLCQCQNGAACDNKSGL 188

Human   333 CVCPSGWHGVHCEKSDRIPQILNMASELEFNLETMPRINCAAAGNPFPVRGSIELRKPDGTVLLS 397
            |.|.:||.|..||..  .||         .....|.|..|.....|...:....:::.....|..
  Fly   189 CHCIAGWTGQFCELP--CPQ---------GTYGIMCRKACDCDEKPCNPQTGACIQQDQPLQLNV 242

Human   398 TKAIVEPEKTTAEFE--VPRLVLADSGFWECRVSTSGGQDSRRFKVNVKVPPVPLAAPRLLT-KQ 459
            :..|||...:|.|..  :||                              |..|:..|.::. ||
  Fly   243 SHVIVETVNSTLEKMGIIPR------------------------------PTTPVPLPEVIVIKQ 277

Human   460 SRQLVVSPLVSFSGDGPISTVRLHYRPQDSTMDWSTIVVDPSENVTLMNLR---------PKTGY 515
                            |.|.....:.|:        |:|..|.:..|.||.         |:..:
  Fly   278 ----------------PTSNENAQHSPK--------IIVHQSSSDLLENLHTAAAAGVPTPEVIH 318

Human   516 SVRVQLSRPGE------GGEGAWGPPTLMTTDCPEPLLQPWLEGWHVEGTDRLRVSWSLPLVPGP 574
            .:...::.|.|      |||.  ......|.|             |..|.....||..|.|:...
  Fly   319 VITNGITSPQEHLAGFVGGEA--NSSQTATAD-------------HQSGLVVTLVSIMLLLLVAI 368

Human   575 LVGDGFLLRLWDGTRGQERRENVSSPQARTALLTGLTPGTHYQLDVQLYHCTLLG-------PAS 632
            .||..::.|.:       ..:|.:...|...:.|  .|...   :|.|....:||       |..
  Fly   369 AVGSLYVYRRY-------HHKNAAVYNANGTVTT--LPANP---EVVLTEAAVLGKNFHEPLPEP 421

Human   633 PPAHVLLPPSGPPAPRHLHAQALSDSEIQ 661
            |.|..:.|.|....| .|:....::|.|:
  Fly   422 PVAFAVTPQSNEAQP-ELYDSPSNNSSIK 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TIE1NP_005415.1 ig 129..210 CDD:278476 9/33 (27%)
EGF_CA 227..256 CDD:238011 8/51 (16%)
EGF_2 315..344 CDD:285248 16/29 (55%)
ig 356..441 CDD:278476 12/86 (14%)
fn3 452..536 CDD:278470 18/99 (18%)
fn3 548..632 CDD:278470 18/90 (20%)
FN3 644..736 CDD:238020 4/18 (22%)
PTKc_Tie1 836..1132 CDD:270671
TyrKc 839..1107 CDD:197581
NimANP_001285918.1 EMI 52..116 CDD:284877 10/63 (16%)
EGF_2 170..200 CDD:285248 16/29 (55%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.