DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TIAL1 and Ref1

DIOPT Version :10

Sequence 1:NP_001029097.1 Gene:TIAL1 / 7073 HGNCID:11804 Length:392 Species:Homo sapiens
Sequence 2:NP_651968.1 Gene:Ref1 / 44029 FlyBaseID:FBgn0010774 Length:266 Species:Drosophila melanogaster


Alignment Length:108 Identity:33/108 - (30%)
Similarity:42/108 - (38%) Gaps:20/108 - (18%)


- Green bases have known domain annotations that are detailed below.


Human   116 VFVGDLSPEITTEDIKSAFAPFGKISDARVVKDMATGKSKGYGFVSFYNKLDAENAIVHMGGQWL 180
            :.||:|...::..|||..|..||.|..|.|..| .:|:|.|...|.|..:.||..||....|..|
  Fly   111 LIVGNLDYGVSNTDIKELFNDFGPIKKAAVHYD-RSGRSLGTADVIFERRADALKAIKQYHGVPL 174

Human   181 GGRQIRTNWATRKPPAPKSTQENNTKQLRFEDVVNQSSPKNCT 223
            .||.:                   |.||...||...:.|...|
  Fly   175 DGRPM-------------------TIQLAVSDVAVLTRPVAAT 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TIAL1NP_001029097.1 RRM1_TIAR 10..107 CDD:410028
RRM2_TIAR 113..192 CDD:410029 26/75 (35%)
RRM3_TIAR 222..294 CDD:241064 1/2 (50%)
Ref1NP_651968.1 sex-lethal 31..>184 CDD:273740 28/92 (30%)
RRM_THOC4 109..183 CDD:410081 27/91 (30%)
FoP_duplication 202..>260 CDD:464005
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.