DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TIAL1 and bol

DIOPT Version :10

Sequence 1:NP_001029097.1 Gene:TIAL1 / 7073 HGNCID:11804 Length:392 Species:Homo sapiens
Sequence 2:NP_001261614.1 Gene:bol / 39049 FlyBaseID:FBgn0011206 Length:233 Species:Drosophila melanogaster


Alignment Length:106 Identity:31/106 - (29%)
Similarity:49/106 - (46%) Gaps:25/106 - (23%)


- Green bases have known domain annotations that are detailed below.


Human   116 VFVGDLSPEITTEDIKSAFAPFGKISDARVVKDMATGKSKGYGFVSFYNKLDAENAIVHMGGQWL 180
            :|||.:|.:.|..|:...|:.:|.:...:::.|.| |.|||||||:|..:.:|:.  :...|:.:
  Fly    35 IFVGGISGDTTEADLTRVFSAYGTVKSTKIIVDRA-GVSKGYGFVTFETEQEAQR--LQADGECV 96

Human   181 GGRQ-------------------IRTNWA---TRKPPAPKS 199
            ..|.                   :.||.|   |..||||.|
  Fly    97 VLRDRKLNIAPAIKKQPNPLQSIVATNGAVYYTTTPPAPIS 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TIAL1NP_001029097.1 RRM1_TIAR 10..107 CDD:410028
RRM2_TIAR 113..192 CDD:410029 25/97 (26%)
RRM3_TIAR 222..294 CDD:241064
bolNP_001261614.1 RRM_DAZL_BOULE 31..111 CDD:409846 22/78 (28%)
PABP-1234 <45..219 CDD:130689 27/96 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.