DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TIAL1 and tra2

DIOPT Version :10

Sequence 1:NP_001029097.1 Gene:TIAL1 / 7073 HGNCID:11804 Length:392 Species:Homo sapiens
Sequence 2:NP_476764.1 Gene:tra2 / 36619 FlyBaseID:FBgn0003742 Length:264 Species:Drosophila melanogaster


Alignment Length:94 Identity:23/94 - (24%)
Similarity:48/94 - (51%) Gaps:15/94 - (15%)


- Green bases have known domain annotations that are detailed below.


Human     9 RTLYVGNLSRDVTEVLILQLFSQIGPCKSCKMITEQPDSRRVNSSVGFSVLQHTSNDPYCFVEFY 73
            |.:.|..|:.:.::..:.:||::.||.:..:|:.:....|    |.||           ||:.|.
  Fly    97 RCIGVFGLNTNTSQHKVRELFNKYGPIERIQMVIDAQTQR----SRGF-----------CFIYFE 146

Human    74 EHRDAAAALAAMNGRKILGKEVKVNWATT 102
            :..||.||..:.:|.::.|:.::|:::.|
  Fly   147 KLSDARAAKDSCSGIEVDGRRIRVDFSIT 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TIAL1NP_001029097.1 RRM1_TIAR 10..107 CDD:410028 22/93 (24%)
RRM2_TIAR 113..192 CDD:410029
RRM3_TIAR 222..294 CDD:241064
tra2NP_476764.1 RRM_TRA2 96..175 CDD:409798 22/92 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.