DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TIAL1 and CG10466

DIOPT Version :10

Sequence 1:NP_001029097.1 Gene:TIAL1 / 7073 HGNCID:11804 Length:392 Species:Homo sapiens
Sequence 2:NP_610003.1 Gene:CG10466 / 35268 FlyBaseID:FBgn0032822 Length:154 Species:Drosophila melanogaster


Alignment Length:117 Identity:29/117 - (24%)
Similarity:56/117 - (47%) Gaps:8/117 - (6%)


- Green bases have known domain annotations that are detailed below.


Human    96 KVNWATTPSSQKKDTSNHFHVFVGDLSPEITTEDIKSAFAPFGKISDARVVKDMATGKSKGYGFV 160
            |.:|    ....||::   .:||......:|..|:...|:.:|::.:..:::|..||||||:.|:
  Fly    23 KKSW----HDMYKDSA---WIFVAGFPYTLTEGDLVCVFSQYGEVVNINLIRDSKTGKSKGFCFL 80

Human   161 SFYNKLDAENAIVHMGGQWLGGRQIRTNW-ATRKPPAPKSTQENNTKQLRFE 211
            .:.::.....|:.::.|..:..|.:|.:. |..|||......:..|.:|..|
  Fly    81 CYEDQRSTVLAVDNLNGIKILDRTLRVDHVADYKPPKENEKMDEETLRLYME 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TIAL1NP_001029097.1 RRM1_TIAR 10..107 CDD:410028 2/10 (20%)
RRM2_TIAR 113..192 CDD:410029 19/79 (24%)
RRM3_TIAR 222..294 CDD:241064
CG10466NP_610003.1 RRM_ist3_like 25..113 CDD:409845 22/94 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.