DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TIAL1 and Rsf1

DIOPT Version :10

Sequence 1:NP_001029097.1 Gene:TIAL1 / 7073 HGNCID:11804 Length:392 Species:Homo sapiens
Sequence 2:NP_477001.2 Gene:Rsf1 / 34370 FlyBaseID:FBgn0011305 Length:200 Species:Drosophila melanogaster


Alignment Length:79 Identity:22/79 - (27%)
Similarity:42/79 - (53%) Gaps:5/79 - (6%)


- Green bases have known domain annotations that are detailed below.


Human   116 VFVGDLSPEITTEDIKSAFAPFGKISDARVVKDMATGKSKGYGFVSFYNKLDAENAIVHMGGQWL 180
            |:||:|:.::..:|::..|..:||::...:..:     ..|:.||.|.::.|||.|...:.|..|
  Fly    12 VYVGNLTDKVKKDDLEGEFTKYGKLNSVWIAFN-----PPGFAFVEFEHRDDAEKACDILNGSEL 71

Human   181 GGRQIRTNWATRKP 194
            .|.|:|...:..:|
  Fly    72 LGSQLRVEISKGRP 85

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TIAL1NP_001029097.1 RRM1_TIAR 10..107 CDD:410028
RRM2_TIAR 113..192 CDD:410029 21/75 (28%)
RRM3_TIAR 222..294 CDD:241064
Rsf1NP_477001.2 RRM_SRSF3_like 11..82 CDD:409808 21/74 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.