DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TIAL1 and eIF4B

DIOPT Version :10

Sequence 1:NP_001029097.1 Gene:TIAL1 / 7073 HGNCID:11804 Length:392 Species:Homo sapiens
Sequence 2:NP_001015319.1 Gene:eIF4B / 3355041 FlyBaseID:FBgn0020660 Length:459 Species:Drosophila melanogaster


Alignment Length:111 Identity:25/111 - (22%)
Similarity:49/111 - (44%) Gaps:12/111 - (10%)


- Green bases have known domain annotations that are detailed below.


Human   114 FHVFVGDLSPEITTEDIKSAFAPFGKISDARVVKDMATGKSKGYGFVSFYNKLDAENAIVH---M 175
            |..::.:|..:...:|:...|.....||.....:|...|:|:|:|:|...|:.|    ::|   :
  Fly    80 FIAYINNLPFDANEDDLYEFFEGINLISLRLPREDGENGRSRGFGYVELENRED----LIHVLSL 140

Human   176 GGQWLGGRQIRTNWATRKPPAPKSTQENNTKQLRFEDVVNQSSPKN 221
            ....:.||:||...:....  .:|.|::|.   ||:...|....::
  Fly   141 PDPSIKGRRIRIELSNEND--QQSRQKSNR---RFDGFGNNGDNRD 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TIAL1NP_001029097.1 RRM1_TIAR 10..107 CDD:410028
RRM2_TIAR 113..192 CDD:410029 19/80 (24%)
RRM3_TIAR 222..294 CDD:241064 25/111 (23%)
eIF4BNP_001015319.1 RRM_eIF4B 78..159 CDD:409836 19/82 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.