DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment KLF10 and Spps

DIOPT Version :9

Sequence 1:NP_005646.1 Gene:KLF10 / 7071 HGNCID:11810 Length:480 Species:Homo sapiens
Sequence 2:NP_001262902.1 Gene:Spps / 42882 FlyBaseID:FBgn0039169 Length:985 Species:Drosophila melanogaster


Alignment Length:535 Identity:133/535 - (24%)
Similarity:217/535 - (40%) Gaps:127/535 - (23%)


- Green bases have known domain annotations that are detailed below.


Human     9 QQTAEERMEMISERPKESMYSWNKTAEKSDFEAVEALMSMSCSWKSDFKKYVENRPVTPVSDLSE 73
            ||..:::.:..:::.:::.....:..::...:|....:..:.|..|...:...|:|:|..:...:
  Fly   387 QQVQQQQQQQQAQQQQQAQQQQAQQQQQQQVQAQHQQLLQAISDASAGGQLPPNQPITITNAQGQ 451

Human    74 EENLLPG--TPDFHTIPAFCLTPPYSPSDF-EPSQVSNLMA-PAPS--------TVHFKSLSDTA 126
            :..::|.  .|:..|.|    ||  :|:.. .|.|:.||.| |..:        .:|...|    
  Fly   452 QLTVIPAQLRPNAPTAP----TP--APAGVPTPMQMPNLQALPIQNIPGLGQVQIIHANQL---- 506

Human   127 KPHIAAPFK-----------------EEEKSPVSAPKLPKAQATSVIRHTADAQLCNHQTCPMKA 174
            .|::.|.|:                 :.:..|...|:.|....||:.:...|.      ..|:.|
  Fly   507 PPNLPANFQQVLTQLPMSHPQVQTQGQVQVMPKQEPQSPTQMITSIKQEPPDT------FGPISA 565

Human   175 ASILNYQNNSFRRRTHLNVEAARKNIPCAAVSPNRSKCERNTVADVDEKASAALYDFSVPSSETV 239
            ..                      |.|..|.:||.:..::..:..:..: |.:|...|:|:|..:
  Fly   566 TG----------------------NPPAPASTPNTASPQQQQIKFLHTE-SNSLSSLSIPASIQI 607

Human   240 ICRSQPAPVSPQQKSVLVSPPAVSAGGVPPMPVICQMVPLPANNPVVTTVVPSTPPSQPPAVCPP 304
                   ...|||.:...:.||.:    .|:|     |.|||.:.|......||..:..| ....
  Fly   608 -------TALPQQATNTPNTPATT----QPIP-----VSLPARSKVNAVTTSSTQITIAP-TGGQ 655

Human   305 VVFMGTQVPKGAVMFVVPQPVVQSSKPPVVSPNGTRLS---------PIAPAPGFSPSAAKVTPQ 360
            ||.:.||. :||...:   ....:|...:.:|:.:.|:         ..|...|...:..:..|:
  Fly   656 VVSVTTQA-RGATASI---RSTNTSTTTITTPSQSHLNMNISVASVGGAATGGGGGTATGEPKPR 716

Human   361 I---------------DSSRIRSHICSHPGCGKTYFKSSHLKAHTRTHTGEKPFSCSWKGCERRF 410
            :               .|.:.|.|||...||.|.|.|:|||:||.|.||||:||.|||..|.:||
  Fly   717 LKRVACTCPNCTDGEKHSDKKRQHICHITGCHKVYGKTSHLRAHLRWHTGERPFVCSWAFCGKRF 781

Human   411 ARSDELSRHRRTHTGEKKFACPMCDRRFMRSDHLTKHARRHLSAK--------------KLPNWQ 461
            .|||||.||||||||||:|.|..|:::|||||||:||.:.|..::              |..|..
  Fly   782 TRSDELQRHRRTHTGEKRFQCQECNKKFMRSDHLSKHIKTHFKSRSGVELIELSIKQETKGGNAP 846

Human   462 MEVSKLNDIALPPTP 476
            ..:|.:|.|.....|
  Fly   847 KSISTVNGIVTIEIP 861

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KLF10NP_005646.1 zf-C2H2 369..393 CDD:278523 14/23 (61%)
COG5048 374..>424 CDD:227381 33/49 (67%)
C2H2 Zn finger 374..393 CDD:275368 11/18 (61%)
zf-H2C2_2 385..412 CDD:290200 17/26 (65%)
C2H2 Zn finger 401..423 CDD:275368 15/21 (71%)
zf-H2C2_2 415..438 CDD:290200 15/22 (68%)
zf-C2H2 429..451 CDD:278523 12/21 (57%)
C2H2 Zn finger 431..451 CDD:275368 11/19 (58%)
SppsNP_001262902.1 COG5048 <725..827 CDD:227381 56/101 (55%)
C2H2 Zn finger 742..764 CDD:275368 12/21 (57%)
zf-H2C2_2 756..783 CDD:290200 17/26 (65%)
C2H2 Zn finger 772..794 CDD:275368 15/21 (71%)
zf-H2C2_2 786..809 CDD:290200 15/22 (68%)
zf-C2H2 800..822 CDD:278523 12/21 (57%)
C2H2 Zn finger 802..822 CDD:275368 11/19 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6780
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.