| Sequence 1: | NP_003237.2 | Gene: | THBS1 / 7057 | HGNCID: | 11785 | Length: | 1170 | Species: | Homo sapiens |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_508745.1 | Gene: | F14H12.3 / 180709 | WormBaseID: | WBGene00017471 | Length: | 257 | Species: | Caenorhabditis elegans |
| Alignment Length: | 242 | Identity: | 87/242 - (35%) |
|---|---|---|---|
| Similarity: | 106/242 - (43%) | Gaps: | 48/242 - (19%) |
- Green bases have known domain annotations that are detailed below.
|
Human 364 PDGECCPRCWPSDSADDGWSPWSEWTSCSTSCGNGIQQRGRSCDSLNNRCE-GSSVQTRTCHIQE 427
Human 428 CDKRFKQDGGWSHWSPWSSCSVTCGDGVITRIRLCNSPSPQMNG---KPCEGEARETKACKKDAC 489
Human 490 PINGGWGPWSPWDICSVTCG-GGVQKRSRLCNNPTPQFGGKDCVGDVTENQICNKQ-DCPIDGCL 552
Human 553 S-----NPC-------FAGVKCTS--YPDGSWKCGACPPGYS--GNG 583 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| THBS1 | NP_003237.2 | TSPN | 26..221 | CDD:214560 | |
| Heparin-binding | 47..95 | ||||
| VWC | 318..372 | CDD:278520 | 3/7 (43%) | ||
| TSP_1 | 383..428 | CDD:395043 | 18/45 (40%) | ||
| TSP1 | 438..490 | CDD:214559 | 24/54 (44%) | ||
| TSP1 | 495..547 | CDD:214559 | 22/53 (42%) | ||
| EGF_3 | 650..689 | CDD:403986 | |||
| TSP type-3 1 | 691..726 | ||||
| TSP3 repeat_1C | 691..726 | CDD:275367 | |||
| TSP type-3 2 | 727..762 | ||||
| TSP type-3 3 | 763..785 | ||||
| TSP3 repeat_short | 763..785 | CDD:275365 | |||
| TSP type-3 4 | 786..821 | ||||
| TSP_3 | 786..821 | CDD:367074 | |||
| TSP3 repeat_long | 787..821 | CDD:275366 | |||
| TSP type-3 5 | 822..844 | ||||
| TSP3 repeat_short | 822..844 | CDD:275366 | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 839..934 | ||||
| TSP3 repeat_long | 845..882 | CDD:275365 | |||
| TSP_3 | 846..882 | CDD:367074 | |||
| TSP3 repeat_short | 883..918 | CDD:275366 | |||
| TSP type-3 8 | 919..954 | ||||
| TSP_3 | 919..952 | CDD:367074 | |||
| Cell attachment site. /evidence=ECO:0000305 | 926..928 | ||||
| TSP_C | 972..1169 | CDD:399035 | |||
| F14H12.3 | NP_508745.1 | TSP_1 | <39..86 | CDD:301595 | 19/48 (40%) |
| TSP1 | 91..139 | CDD:214559 | 24/53 (45%) | ||
| TSP1 | 142..187 | CDD:214559 | 21/50 (42%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 1 | 1.000 | - | - | FOG0001167 | |
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 1 | 1.000 | - | - | ||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 3 | 2.910 | |||||