DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment THBD and frac

DIOPT Version :9

Sequence 1:NP_000352.1 Gene:THBD / 7056 HGNCID:11784 Length:575 Species:Homo sapiens
Sequence 2:NP_001137905.1 Gene:frac / 38850 FlyBaseID:FBgn0035798 Length:1618 Species:Drosophila melanogaster


Alignment Length:641 Identity:162/641 - (25%)
Similarity:217/641 - (33%) Gaps:215/641 - (33%)


- Green bases have known domain annotations that are detailed below.


Human    21 AEPQPGGSQCVE--------HDCFAL----YPGPATFLN---ASQICDGLRG----------HLM 60
            :|.||.|..|..        .||..:    ..||....|   ..|.|:...|          ||:
  Fly   388 SESQPAGKTCNSGFQLSADGTDCQDINECEVDGPEDLDNNAVCQQKCENTIGSFRCTCVEGYHLL 452

Human    61 TVRSSVAADVISLLLNGDGGVGRRRLWIGLQ-LPPG---CGDPKRLGPLRGFQ------------ 109
            ..:.|.|.|..:.|.|..  :.|.|.....| ||.|   |..||      |::            
  Fly   453 EDQRSCALDSCTDLENPQ--LNRTRCAHECQDLPEGSYRCVCPK------GYELSEDQHSCLVQE 509

Human   110 ----------------WVTGDNNTSYS----------RWARLDLN----GAPLCGPLCVAVSAA- 143
                            .:..::|||:|          .::..|::    ...||...|...... 
  Fly   510 SPCSTEKGVEKCSPGTCLASEDNTSFSCICPTGYRSEAFSCQDIDECAEDTHLCSHTCQNTPGGY 574

Human   144 ------------EATVPSEPIWE------EQQC--------------EVKADGFLCE-------- 168
                        |.|..:|.:.|      ||.|              .:.|||..||        
  Fly   575 QCQCPEGLNLVEEYTCLAENLCEVNNNGCEQICLTARGGVCACREGFRLSADGKSCEDVDECLVN 639

Human   169 -FHFPATCRPLAVEPGAAAAAVSITYGTPFAA----------RGADF-------QALPVGSSAAV 215
             ......||.|   ||        :||...||          ||..|       :..........
  Fly   640 NGGCQQVCRNL---PG--------SYGCICAAGYELLKLDGIRGYCFDIDECSQRTHGCSDQMLC 693

Human   216 APLGLQLMCTAPPGAVQG----------------HWAREAPGAW------DCSVENGGCEHACNA 258
            ..|.....|..|||...|                ..:.|.|.|.      :||:.||.|.|.|..
  Fly   694 ENLNGSYTCLCPPGYALGLDNHIVTSLNSSFITDSTSSETPSAHTCLDIDECSLANGNCSHFCQN 758

Human   259 IPGAPRCQCPAGAALQADGRSCTASATQSC---NDLCEHFCVPNPDQPGSYSCMCETGYRLAADQ 320
            .||..:|.||.|.||..|.|:|  .....|   |..|...|:   :|||.::|.||||:.|..|.
  Fly   759 EPGGFQCACPLGYALSEDMRTC--QDIDECLDSNGQCSQLCL---NQPGGFACACETGFELTPDG 818

Human   321 HRCEDVDDCILEPSPCPQRCVNTQGGFECHCYPNYDLVDGE--CVEPVDPC---FRANCEYQCQP 380
            ..|.|:|:|..:...|...|:|..|...|.|...|:|...:  |:: ||.|   ....|.::|  
  Fly   819 FGCADIDECSQDYGNCSDICINLLGTHACACERGYELAKDKLSCLD-VDECAGLLSGGCSHEC-- 880

Human   381 LNQT-SYLCVCAEGFAPIPHEPHRCQMFCNQTACPA--DCDPNTQASC------ECPEGYILDDG 436
            :|:. ::.|.|..|:  |.::..|       :..||  .|.|.||.|.      ||..||.|...
  Fly   881 INKAGTFECGCPLGY--ILNDDGR-------SCSPALVGCPPGTQRSADGCAPIECNPGYTLGSD 936

Human   437 FICTDIDEC--ENGGFCSGVCHNLPGTFECICGP------DSALARHIGTDCDSGK 484
            ..|.|||||  :||| ||..|.|..|:|:|.|.|      |....:.| .:||..|
  Fly   937 DKCVDIDECQKQNGG-CSHRCSNTEGSFKCSCPPGYELDSDQKTCQDI-DECDQDK 990

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
THBDNP_000352.1 CLECT_thrombomodulin_like 30..171 CDD:153070 46/253 (18%)
FXa_inhibition 245..280 CDD:291342 17/34 (50%)
FXa_inhibition 289..323 CDD:291342 13/33 (39%)
EGF_CA 325..>355 CDD:214542 9/29 (31%)
Tme5_EGF_like 406..439 CDD:286192 12/40 (30%)
EGF_CA 441..>468 CDD:214542 16/28 (57%)
Involved in alpha-L/beta-2 and alpha-M/beta-2 integrin binding. /evidence=ECO:0000269|PubMed:27055590 481..515 2/4 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 484..506 1/1 (100%)
fracNP_001137905.1 FXa_inhibition 296..331 CDD:291342
cEGF 396..415 CDD:289433 3/18 (17%)
FXa_inhibition 425..458 CDD:291342 6/32 (19%)
FXa_inhibition 476..505 CDD:291342 8/34 (24%)
vWFA <550..586 CDD:294047 4/35 (11%)
FXa_inhibition 596..630 CDD:291342 7/33 (21%)
FXa_inhibition 636..>664 CDD:291342 9/38 (24%)
EGF_CA 676..715 CDD:284955 6/38 (16%)
FXa_inhibition 745..780 CDD:291342 17/34 (50%)
FXa_inhibition 786..821 CDD:291342 14/37 (38%)
FXa_inhibition 827..862 CDD:291342 9/34 (26%)
FXa_inhibition 874..904 CDD:291342 8/40 (20%)
FXa_inhibition 945..980 CDD:291342 14/35 (40%)
CCP 1110..1170 CDD:153056
CCP 1183..1235 CDD:153056
DUF5011 1468..1536 CDD:295940
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.