DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rnf167 and DMA1

DIOPT Version :9

Sequence 1:NP_081721.1 Gene:Rnf167 / 70510 MGIID:1917760 Length:347 Species:Mus musculus
Sequence 2:NP_011983.1 Gene:DMA1 / 856515 SGDID:S000001157 Length:416 Species:Saccharomyces cerevisiae


Alignment Length:125 Identity:39/125 - (31%)
Similarity:58/125 - (46%) Gaps:21/125 - (16%)


- Green bases have known domain annotations that are detailed below.


Mouse   189 GTVLIVRCIQHR------KRLQRNRLTKEQLKQIPTHDYQK---GDEYDVCAICLDEYEDGDKLR 244
            ||..|.||::.:      .:|:.|...||.|.:|  .:.||   |.|.:.|:|||::.:....:.
Yeast   279 GTEEIYRCVKMKIELNKSWKLKANAFNKEALSRI--KNLQKLTTGLEQEDCSICLNKIKPCQAIF 341

Mouse   245 VLPCAHAYHSRCVDPW--LTQTRKTCPICKQPVHRGPGDEE---QEEETQEQEEGDEGEP 299
            :.||||::|..||...  :...:..||.|     |...|.|   :.|...|.|..||.||
Yeast   342 ISPCAHSWHFHCVRRLVIMNYPQFMCPNC-----RTNCDLETTLESESESEFENEDEDEP 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rnf167NP_081721.1 PA_C_RZF_like 20..170 CDD:239038
zf-RING_2 228..272 CDD:290367 13/45 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 271..347 11/32 (34%)
DMA1NP_011983.1 FHA 121..308 CDD:224630 8/28 (29%)
RING-H2_Dmap_like 325..371 CDD:319372 14/50 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X670
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.