DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rnf167 and DMA2

DIOPT Version :9

Sequence 1:NP_081721.1 Gene:Rnf167 / 70510 MGIID:1917760 Length:347 Species:Mus musculus
Sequence 2:NP_014283.3 Gene:DMA2 / 855607 SGDID:S000005060 Length:522 Species:Saccharomyces cerevisiae


Alignment Length:131 Identity:41/131 - (31%)
Similarity:65/131 - (49%) Gaps:19/131 - (14%)


- Green bases have known domain annotations that are detailed below.


Mouse   183 LLVLAM----GTVLIVRCIQHRKRLQR------NRLTKEQLKQIPTHDYQK---GDEYDVCAICL 234
            :|.|.|    ||..|.||::.|..|.|      |...||.|:::  .:.||   |.|.:.|:|||
Yeast   375 ILQLGMDFRGGTEEIYRCVRMRIELNRSWKLKANSFNKEALQRL--QNLQKLTTGIEEEDCSICL 437

Mouse   235 DEYEDGDKLRVLPCAHAYHSRCVD--PWLTQTRKTCPICKQPVHRGPGDE--EQEEETQEQEEGD 295
            .:.:....:.:.||||::|.|||.  ..|:..:..||.|:.........|  ::|:|:..:.|||
Yeast   438 CKIKPCQAIFISPCAHSWHFRCVRRLVMLSYPQFVCPNCRSSCDLEASFESSDEEDESDVESEGD 502

Mouse   296 E 296
            :
Yeast   503 Q 503

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rnf167NP_081721.1 PA_C_RZF_like 20..170 CDD:239038
zf-RING_2 228..272 CDD:290367 15/45 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 271..347 7/28 (25%)
DMA2NP_014283.3 FHA 228..417 CDD:224630 15/41 (37%)
RING-H2_Dmap_like 431..477 CDD:319372 15/45 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X670
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.