DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TGFBR1 and tkv

DIOPT Version :9

Sequence 1:NP_001293139.1 Gene:TGFBR1 / 7046 HGNCID:11772 Length:507 Species:Homo sapiens
Sequence 2:NP_787990.1 Gene:tkv / 33753 FlyBaseID:FBgn0003716 Length:575 Species:Drosophila melanogaster


Alignment Length:534 Identity:243/534 - (45%)
Similarity:310/534 - (58%) Gaps:70/534 - (13%)


- Green bases have known domain annotations that are detailed below.


Human    21 AAAAAALL-------PG-----------------ATALQCFCHLCTKDNF---TCVT--DGLCFV 56
            |.|||||.       ||                 |.:|.|:|.....||.   ||.|  .|.||.
  Fly    44 AMAAAALSGMEMGSGPGSEGYEDADNEKSKTVENARSLTCYCDGSCPDNVSNGTCETRPGGSCFS 108

Human    57 SVTETTDKVIHNSMCIAEIDLIPRDRPFVCAPSSKTGSV-------------TTTYCCN-QDHCN 107
            :|.:..|:.         ..:...:|.:.|.|....|..             ....||: :|.||
  Fly   109 AVQQLYDET---------TGMYEEERTYGCMPPEDNGGFLMCKVAAVPHLHGKNIVCCDKEDFCN 164

Human   108 KIELPTTGPFSVKSSPGLGPV-----ELAAVIAGPVCFVCISLMLMVYICHNRTVIHHRVPNEED 167
            :...||..|.....:|.| ||     ...||....:..:.:.::::..:|.   ....|....:.
  Fly   165 RDLYPTYTPKLTTPAPDL-PVSSESLHTLAVFGSIIISLSVFMLIVASLCF---TYKRREKLRKQ 225

Human   168 PSLDRPFI-SEGTTLKDLIYDMTTSGSGSGLPLLVQRTIARTIVLQESIGKGRFGEVWRGKWRGE 231
            |.|..... |:.:.|..|:..  :||||||||||||||||:.|.:...:||||:||||..|||.|
  Fly   226 PRLINSMCNSQLSPLSQLVEQ--SSGSGSGLPLLVQRTIAKQIQMVRLVGKGRYGEVWLAKWRDE 288

Human   232 EVAVKIFSSREERSWFREAEIYQTVMLRHENILGFIAADNKDNGTWTQLWLVSDYHEHGSLFDYL 296
            .||||.|.:.||.|||||.||||||::||:|||||||||.|.||:|||:.|::||||.|||.|||
  Fly   289 RVAVKTFFTTEEASWFRETEIYQTVLMRHDNILGFIAADIKGNGSWTQMLLITDYHEMGSLHDYL 353

Human   297 NRYTVTVEGMIKLALSTASGLAHLHMEIVGTQGKPAIAHRDLKSKNILVKKNGTCCIADLGLAVR 361
            :...:..:.:..||.|.||||||||.||.||.|||||||||:||||||||:||.|.|||.||||:
  Fly   354 SMSVINPQKLQLLAFSLASGLAHLHDEIFGTPGKPAIAHRDIKSKNILVKRNGQCAIADFGLAVK 418

Human   362 HDSATDTIDIAPNHRVGTKRYMAPEVLDDSINMKHFESFKRADIYAMGLVFWEIARRC--SIGGI 424
            ::|..|.|.||.|.||||:||||||||...::.|.||.|||||:|::|||.||:.|||  .:.|.
  Fly   419 YNSELDVIHIAQNPRVGTRRYMAPEVLSQQLDPKQFEEFKRADMYSVGLVLWEMTRRCYTPVSGT 483

Human   425 H----EDYQLPYYDLVPSDPSVEEMRKVVCEQKLRPNIPNRWQSCEALRVMAKIMRECWYANGAA 485
            .    |||.|||:|:|||||:.|:|..|||.:..||.||:|||..:.|..::|||:|||:.|...
  Fly   484 KTTTCEDYALPYHDVVPSDPTFEDMHAVVCVKGFRPPIPSRWQEDDVLATVSKIMQECWHPNPTV 548

Human   486 RLTALRIKKTLSQL 499
            ||||||:||||.:|
  Fly   549 RLTALRVKKTLGRL 562

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TGFBR1NP_001293139.1 Activin_recp 35..114 CDD:279413 22/97 (23%)
TGF_beta_GS 180..207 CDD:285687 17/26 (65%)
Pkinase_Tyr 209..496 CDD:285015 177/292 (61%)
STKc_TGFbR1_ACVR1b_ACVR1c 213..500 CDD:271045 179/293 (61%)
tkvNP_787990.1 Activin_recp 81..171 CDD:279413 23/98 (23%)
GS 238..266 CDD:197743 18/29 (62%)
S_TKc 267..557 CDD:214567 174/289 (60%)
STKc_BMPR1 270..562 CDD:271046 178/291 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2052
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D338017at33208
OrthoFinder 1 1.000 - - FOG0000203
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X151
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.