DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LEFTY2 and scw

DIOPT Version :9

Sequence 1:NP_003231.2 Gene:LEFTY2 / 7044 HGNCID:3122 Length:366 Species:Homo sapiens
Sequence 2:NP_001286088.1 Gene:scw / 46000 FlyBaseID:FBgn0005590 Length:400 Species:Drosophila melanogaster


Alignment Length:311 Identity:68/311 - (21%)
Similarity:110/311 - (35%) Gaps:83/311 - (26%)


- Green bases have known domain annotations that are detailed below.


Human    90 LASEASTHLLVFGMEQRLPPNSELVQAVLRLFQEPVPKAALHRHGRLSPRSAQARVTV-EWLRVR 153
            |.:|...| :.|.... :|.:..||||:||::::|          .|..|.|...|:| ..|..|
  Fly   125 LDNELDMH-ITFNTND-VPVDLSLVQAMLRIYKQP----------SLVDRRANFTVSVYRKLDNR 177

Human   154 DDGSNRTSLIDSRLVSVHESGWKAFDVTEAVNFWQQLSRPRQPLLLQVSVQREHLGPLASGAHKL 218
            .|.|.|  ::.|...:..:.||..|::|:.:.:|          |....:||.:...::.|..:|
  Fly   178 QDFSYR--ILGSVNTTSSQRGWLEFNLTDTLRYW----------LHNKGLQRRNELRISIGDSQL 230

Human   219 VRFASQGAPAGLGEPQLELHTL------------------------DLRDYGAQGDCDPEAP--- 256
            ..||     |||..||....:|                        ||....|.|...|..|   
  Fly   231 STFA-----AGLVTPQASRTSLEPFIVGYFNGPELLVKIQKLRFKRDLEKRRAGGGSPPPPPPPP 290

Human   257 ---MTEGTRCCRQEMYIDLQGMKWAKNWVLEPPGFLAYECVGTCQQP-------------PEALA 305
               ......|.|....:|.:.:. ..|||:.|..|.||.|.|.|..|             ...:.
  Fly   291 VDLYRPPQSCERLNFTVDFKELH-MHNWVIAPKKFEAYFCGGGCNFPLGTKMNATNHAIVQTLMH 354

Human   306 FNWPFLGPRQCIASETASLPMIVSIKEGGRTRPQVVSLPNMR---VQKCSC 353
            ...|.|....|:.:...::.::..:.|      .::.|...:   .::|.|
  Fly   355 LKQPHLPKPCCVPTVLGAITILRYLNE------DIIDLTKYQKAVAKECGC 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LEFTY2NP_003231.2 TGFb_propeptide <106..214 CDD:307025 27/108 (25%)
TGF_beta 263..353 CDD:306518 20/105 (19%)
scwNP_001286088.1 TGFb_propeptide 39..254 CDD:279078 41/157 (26%)
TGFB 300..400 CDD:214556 21/107 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.