DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TGFB3 and scw

DIOPT Version :9

Sequence 1:NP_001316868.1 Gene:TGFB3 / 7043 HGNCID:11769 Length:412 Species:Homo sapiens
Sequence 2:NP_001286088.1 Gene:scw / 46000 FlyBaseID:FBgn0005590 Length:400 Species:Drosophila melanogaster


Alignment Length:461 Identity:108/461 - (23%)
Similarity:177/461 - (38%) Gaps:125/461 - (27%)


- Green bases have known domain annotations that are detailed below.


Human    14 LLN-FATVSL----SLSTCTTLDFGHIK----KKRVEAIRGQILSKLRLTSPP----EPTVMTHV 65
            :|| |...||    |.:|..|.: .||:    :||..:.:.:::..|.|...|    ||.     
  Fly     1 MLNVFFLTSLFYAASATTYVTTN-NHIEMPIYQKRPLSEQMEMIDILDLGDRPRRQAEPN----- 59

Human    66 PYQVLALYNSTRELLEEMHGEREEGCTQENTESEYYAKEIHK----FDMIQGLAEHNELAVC--- 123
                  |:||..:.|.|::.|     ..|:.|.:....:.||    .|::....:..|:|.|   
  Fly    60 ------LHNSASKFLLEVYNE-----ISEDQEPKEVLHQRHKRSLDDDILISNEDRQEIASCNSI 113

Human   124 --------PKGITSKV---FRFNVSSVEKNRTNLFRAEFRVLRVPNPSSKRNEQRIELFQIL--R 175
                    |:.:.:::   ..||.:.|..: .:|.:|..|:.:.|:...:|....:.:::.|  |
  Fly   114 LTFSSRLKPEQLDNELDMHITFNTNDVPVD-LSLVQAMLRIYKQPSLVDRRANFTVSVYRKLDNR 177

Human   176 PDEHIAKQRYIGGKNLPTRGTAEWLSFDVTDTVREWL----LRRESNLGLEISIHCPCHTF---- 232
            .|   ...|.:|..| .|.....||.|::|||:|.||    |:|.:.|.:.|. .....||    
  Fly   178 QD---FSYRILGSVN-TTSSQRGWLEFNLTDTLRYWLHNKGLQRRNELRISIG-DSQLSTFAAGL 237

Human   233 ----------QP------NGDILENIHEVMEIKFKGVDNEDDHGRGDLGRLKKQKDHHNPHLILM 281
                      :|      ||.  |.:.::.:::||          .||.:.:.......|.    
  Fly   238 VTPQASRTSLEPFIVGYFNGP--ELLVKIQKLRFK----------RDLEKRRAGGGSPPPP---- 286

Human   282 MIPPHRLD--NPGQGGQRKKRALDTNYCFRNLEENCCVRPLYIDFRQDLGWKWVHEPKGYYANFC 344
              ||..:|  .|.|..:|      .|:.              :||::.....||..||.:.|.||
  Fly   287 --PPPPVDLYRPPQSCER------LNFT--------------VDFKELHMHNWVIAPKKFEAYFC 329

Human   345 SGPCPY---LRSADTTHSTVLGLYNTLNPEASASPCCVPQDLEPLTILYYVGR-TPKVEQLSNMV 405
            .|.|.:   .:...|.|:.|..|.:...|.. ..|||||..|..:|||.|:.. ...:.:....|
  Fly   330 GGGCNFPLGTKMNATNHAIVQTLMHLKQPHL-PKPCCVPTVLGAITILRYLNEDIIDLTKYQKAV 393

Human   406 VKSCKC 411
            .|.|.|
  Fly   394 AKECGC 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TGFB3NP_001316868.1 TGFb_propeptide 24..230 CDD:395559 54/237 (23%)
Cell attachment site. /evidence=ECO:0000250|UniProtKB:P01137 261..263 0/1 (0%)
TGF_beta_TGFB3 312..412 CDD:381656 30/104 (29%)
scwNP_001286088.1 TGFb_propeptide 39..254 CDD:279078 51/236 (22%)
TGFB 300..400 CDD:214556 32/121 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.