Sequence 1: | NP_001001979.1 | Gene: | Megf10 / 70417 | MGIID: | 2685177 | Length: | 1147 | Species: | Mus musculus |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001285918.1 | Gene: | NimA / 318930 | FlyBaseID: | FBgn0261514 | Length: | 565 | Species: | Drosophila melanogaster |
Alignment Length: | 195 | Identity: | 66/195 - (33%) |
---|---|---|---|
Similarity: | 91/195 - (46%) | Gaps: | 8/195 - (4%) |
- Green bases have known domain annotations that are detailed below.
Mouse 21 GTASSLNLEDP-NVCSHWESYSVTVQESYPHPFDQIYYTSCTDILNWFKCTRHRISYRTAYRHGE 84
Mouse 85 KTMYRRKSQCCPGF----YESRDMCVPHCADKCVHGRCIAPNTCQCEPGWGGTNCSSACDGDHWG 145
Mouse 146 PHCSSRCQCKNRALCNPITGACHCAAGYRGWRCEDRCEQGTYGNDCHQRCQCQNGATCDHITGEC 210
Mouse 211 210 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Megf10 | NP_001001979.1 | Necessary for interaction with AP2M1, self-assembly and formation of the irregular, mosaic-like adhesion pattern. /evidence=ECO:0000250|UniProtKB:Q96KG7 | 1..857 | 66/195 (34%) | |
EMI | 32..99 | CDD:284877 | 16/70 (23%) | ||
EGF_CA | 281..326 | CDD:304395 | |||
EGF_CA | 542..587 | CDD:304395 | |||
Necessary for formation of large intracellular vacuoles. /evidence=ECO:0000250|UniProtKB:Q96KG7 | 945..1147 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1093..1147 | ||||
NimA | NP_001285918.1 | EMI | 52..116 | CDD:284877 | 15/65 (23%) |
EGF_2 | 170..200 | CDD:285248 | 14/29 (48%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1218 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D561378at2759 | |
OrthoFinder | 1 | 1.000 | - | - | FOG0001631 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
5 | 4.820 |