DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TGFB1 and scw

DIOPT Version :9

Sequence 1:XP_011525544.1 Gene:TGFB1 / 7040 HGNCID:11766 Length:391 Species:Homo sapiens
Sequence 2:NP_001286088.1 Gene:scw / 46000 FlyBaseID:FBgn0005590 Length:400 Species:Drosophila melanogaster


Alignment Length:437 Identity:92/437 - (21%)
Similarity:156/437 - (35%) Gaps:123/437 - (28%)


- Green bases have known domain annotations that are detailed below.


Human    27 AAGLSTCKT----IDMELVKRKRIEAIRGQILSKLRLASPPSQGEVP--PGPLPEAVLALYNSTR 85
            ||..:|..|    |:|.:.:::.:.. :.:::..|.|...|.:...|  .....:.:|.:||.. 
  Fly    13 AASATTYVTTNNHIEMPIYQKRPLSE-QMEMIDILDLGDRPRRQAEPNLHNSASKFLLEVYNEI- 75

Human    86 DRVAGESAEPEPEPEADYYAKEVTR-----------VLMVETHNEIYDKFKQSTHSIYMF----- 134
                  |.:.||        |||..           ::..|...||     .|.:||..|     
  Fly    76 ------SEDQEP--------KEVLHQRHKRSLDDDILISNEDRQEI-----ASCNSILTFSSRLK 121

Human   135 -------------FNTSELREAVPEPVLLSRAELRLLRLKLKVEQH----VELYQKYSNN---SW 179
                         |||::    ||..:.|.:|.||:.:....|::.    |.:|:|..|.   |:
  Fly   122 PEQLDNELDMHITFNTND----VPVDLSLVQAMLRIYKQPSLVDRRANFTVSVYRKLDNRQDFSY 182

Human   180 RYLSNRLLAPSDSPEWLSFDVTGVVRQWLSRGGEIEGFRLSAHCSCDSRDNTLQVDIN------- 237
            |.|.: :...|....||.|::|..:|.||...|.             .|.|.|::.|.       
  Fly   183 RILGS-VNTTSSQRGWLEFNLTDTLRYWLHNKGL-------------QRRNELRISIGDSQLSTF 233

Human   238 -AGFTTGRRGDLATIHGMNRPFLLLMATPLERAQHLQSSRHRRALDTNYCFSST----------- 290
             ||..|.:....:.     .||::......|....:|..|.:|.|:.......:           
  Fly   234 AAGLVTPQASRTSL-----EPFIVGYFNGPELLVKIQKLRFKRDLEKRRAGGGSPPPPPPPPVDL 293

Human   291 ---EKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYS--------KVLALY 344
               .::|......:||::.....|:..||.:.|.||.|.|.:  .|.|:.:        .::.|.
  Fly   294 YRPPQSCERLNFTVDFKELHMHNWVIAPKKFEAYFCGGGCNF--PLGTKMNATNHAIVQTLMHLK 356

Human   345 NQHNPGASAAPCCVPQALEPLPIVYYVGRK-PKVEQLSNMIVRSCKC 390
            ..|.|    .|||||..|..:.|:.|:... ..:.:....:.:.|.|
  Fly   357 QPHLP----KPCCVPTVLGAITILRYLNEDIIDLTKYQKAVAKECGC 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TGFB1XP_011525544.1 TGFb_propeptide 30..262 CDD:395559 59/281 (21%)
TGF_beta_TGFB1 293..391 CDD:381654 26/107 (24%)
scwNP_001286088.1 TGFb_propeptide 39..254 CDD:279078 55/257 (21%)
TGFB 300..400 CDD:214556 26/106 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.