DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TFRC and CG11961

DIOPT Version :9

Sequence 1:NP_001121620.1 Gene:TFRC / 7037 HGNCID:11763 Length:760 Species:Homo sapiens
Sequence 2:NP_001246418.1 Gene:CG11961 / 37221 FlyBaseID:FBgn0034436 Length:891 Species:Drosophila melanogaster


Alignment Length:276 Identity:57/276 - (20%)
Similarity:104/276 - (37%) Gaps:68/276 - (24%)


- Green bases have known domain annotations that are detailed below.


Human   372 NVKLTVSNVLKEIKILNIFGVIKGFVEPDHYVVVGAQRDA--WGPGAAKSGVGTALLLKLAQMF- 433
            |:..::.|::.:|...|        .....|::|.:..|:  .||||...|...|.::::.::. 
  Fly   160 NMYQSIQNIVVKISPKN--------TNSTTYLLVNSHYDSVPAGPGAGDDGSMVATMMEVLRVLA 216

Human   434 -SDMVLKDGFQPSRSIIFASWSAGDFGSVGATEWLEGYLSSLHLKAFTYINLDKAVLGTSNFKVS 497
             ||..||:      .::|....|.:.....:..::..:..:.:.||.  ||||....|.......
  Fly   217 KSDKPLKN------PVVFLFNGAEENPLQASHAFITQHKWAKYCKAL--INLDSCGNGGREILFQ 273

Human   498 ASPLLYTLIEKTMQNVKHP---VTGQFLYQDSNWASKVE-KLTLDNAAFPFLAYSGIPAVSFCFC 558
            :.|....|::...:.:|||   ..|:.|:|.:...|..: ::..|:.:.|.|             
  Fly   274 SGPNHPWLMKNYRRAIKHPYASTMGEELFQHNFIPSDTDFRIFRDHGSVPGL------------- 325

Human   559 EDTDYPYLG-------------------TTMDTYKELIERI---PELNKVARAAA------EVAG 595
             |..|.|.|                   .|.|....|:.:|   ||:...|:.|.      :|.|
  Fly   326 -DMAYTYNGFVYHTRHDKAEIFPRGSFQHTGDNLLALVRQIANSPEIENSAKYAKGHTIYFDVMG 389

Human   596 QFVI--KLTHDVELNL 609
            .|::  ..|..|.||:
  Fly   390 WFLVFYTETEGVILNV 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TFRCNP_001121620.1 Mediates interaction with SH3BP4. /evidence=ECO:0000269|PubMed:16325581 1..67
Endocytosis signal. /evidence=ECO:0000269|PubMed:2298808 20..23
Stop-transfer sequence. /evidence=ECO:0000303|PubMed:6090955 58..61
PA_TfR 201..377 CDD:239043 1/4 (25%)
M28_TfR 385..610 CDD:193572 54/263 (21%)
Ligand-binding 569..760 15/52 (29%)
TFR_dimer 642..750 CDD:282153
Cell attachment site, required for binding to transferrin 646..648
CG11961NP_001246418.1 M28_Fxna_like 91..395 CDD:193497 53/264 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2234
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.