DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TFPI and CG42827

DIOPT Version :9

Sequence 1:NP_001316168.1 Gene:TFPI / 7035 HGNCID:11760 Length:304 Species:Homo sapiens
Sequence 2:NP_651142.3 Gene:CG42827 / 42763 FlyBaseID:FBgn0262009 Length:116 Species:Drosophila melanogaster


Alignment Length:73 Identity:26/73 - (35%)
Similarity:41/73 - (56%) Gaps:0/73 - (0%)


- Green bases have known domain annotations that are detailed below.


Human   217 CLTPADRGLCRANENRFYYNSVIGKCRPFKYSGCGGNENNFTSKQECLRACKKGFIQRISKGGLI 281
            ||..::.|.|:.....::||....||:.|.||.||||.|.|.:|:.|:..|.|...:::.|.||.
  Fly    41 CLQSSEYGKCKGRRKLWFYNPKKSKCQVFIYSNCGGNGNLFYTKESCVEFCGKYDWKKVRKTGLR 105

Human   282 KTKRKRKK 289
            ::...|:|
  Fly   106 RSADYRRK 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TFPINP_001316168.1 Kunitz_BPTI 53..104 CDD:278443
KU 123..175 CDD:238057
Kunitz_BPTI 216..268 CDD:278443 19/50 (38%)
CG42827NP_651142.3 KU 40..92 CDD:238057 19/50 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4295
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6653
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000145
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10083
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.860

Return to query results.
Submit another query.