DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TFPI and tag-290

DIOPT Version :9

Sequence 1:NP_001316168.1 Gene:TFPI / 7035 HGNCID:11760 Length:304 Species:Homo sapiens
Sequence 2:NP_505945.1 Gene:tag-290 / 179593 WormBaseID:WBGene00009386 Length:219 Species:Caenorhabditis elegans


Alignment Length:251 Identity:60/251 - (23%)
Similarity:100/251 - (39%) Gaps:60/251 - (23%)


- Green bases have known domain annotations that are detailed below.


Human    36 HTIITDTELPPLKLMHSF-CAFKADDG-PCKAIM--KRFFFNIFTRQCEEFIYGGCEGNQNRFES 96
            |.::....:|    :.|| |....|.| .|....  :.|:|:...:.|:.|:|.||.||:|||.:
 Worm     4 HLLVCVLLVP----VFSFDCTQPKDSGNVCSGSQAERSFYFDTRMKVCQPFLYSGCGGNENRFST 64

Human    97 LEECKKMCTRDNANRIIKTTLQQEKPDFCFLEEDPGICRG------YITRYFYNNQTKQCERFKY 155
            .:||:..|...      |::...|.||  .:.:|.....|      ::.:...::|.::.:    
 Worm    65 SKECRDACQNK------KSSSTTESPD--TISDDSADQSGSPNSPPFVPQGDGHDQWRKAD---- 117

Human   156 GGCLGNMNNFETLEECKNICEDG---PNGFQVDNYGTQL-----NAVNNSLTPQSTKVPSLFEFH 212
                              ||...   |||..:.....|.     :.||.:..|....|.||.:.:
 Worm   118 ------------------ICGSNYLIPNGKYITCSPNQACPKFHSCVNGACCPSKDYVCSLRDDN 164

Human   213 GPSWCLTPADRGLCRANENRFYYNSVIGKCRPFKYSGCGGNENNFTSKQECLRACK 268
            | |:.....||       .||.:|:.:..|..:.|.|..||.|||.:.|.|::.|:
 Worm   165 G-SFMDGVEDR-------PRFSWNNDVHSCTRWSYYGANGNYNNFPNFQSCMKFCQ 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TFPINP_001316168.1 Kunitz_BPTI 53..104 CDD:278443 19/54 (35%)
KU 123..175 CDD:238057 4/57 (7%)
Kunitz_BPTI 216..268 CDD:278443 15/51 (29%)
tag-290NP_505945.1 Kunitz_BPTI 19..73 CDD:278443 18/53 (34%)
KU 156..211 CDD:197529 20/62 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4295
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 71 1.000 Inparanoid score I4351
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000145
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.860

Return to query results.
Submit another query.