DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TFAP2A and TfAP-2

DIOPT Version :9

Sequence 1:XP_016866721.1 Gene:TFAP2A / 7020 HGNCID:11742 Length:519 Species:Homo sapiens
Sequence 2:NP_001262178.1 Gene:TfAP-2 / 40398 FlyBaseID:FBgn0261953 Length:471 Species:Drosophila melanogaster


Alignment Length:476 Identity:218/476 - (45%)
Similarity:282/476 - (59%) Gaps:69/476 - (14%)


- Green bases have known domain annotations that are detailed below.


Human    83 SAHASAG--SNPALYDQDRHDGTSNGTARLPQLGTVG-QSPYTSAPPLSH-TPNADFQPPYFPPP 143
            |.|.|.|  |..|.|  ..|.|...|.:. |..|..| .|.:.||..:.| :..:||||||||||
  Fly    23 SGHGSLGLSSGSAAY--TTHSGGHTGRSG-PATGHSGHSSTHGSAATMHHQSLQSDFQPPYFPPP 84

Human   144 Y---------QPI--YPQSQDPYSHV-NDPYS--LNPLHAQPQPQHPGWPGQRQSQES-GLLHTH 193
            :         |.|  |.|:.....:: .|||.  |:.||..|...:....|.|.:|:. |:..||
  Fly    85 FHHSTQSPPQQQISGYLQNHGALEYLGTDPYGQPLSSLHHAPLHHYNQLAGLRSTQDQLGIHRTH 149

Human   194 R---------GLPHQLSGLDPRRDYRRHEDLLHGPHALSSG------LG----DLSIH-SLPHAI 238
            |         .|.|.....|.|.||         ..|:|:|      ||    .|::| :|.:|:
  Fly   150 REAELQGHVTQLSHGFPYTDRRSDY---------GSAISAGAAHGTRLGHEHESLALHQALQNAV 205

Human   239 EEV--PHVEDPGINIPDQTVIKKGPVSLSKSNSNAVSAIPINKDNLFGGVVNPNEVFCSVPGRLS 301
            ::|  |.::|....:.|..:||.     .||...|        .|:..|  :|:||||:||||||
  Fly   206 DDVQAPALDDNVAFMSDLPLIKS-----MKSGKEA--------GNIGSG--SPSEVFCAVPGRLS 255

Human   302 LLSSTSKYKVTVAEVQRRLSPPECLNASLLGGVLRRAKSKNGGRSLREKLDKIGLNLPAGRRKAA 366
            |||||||||||:||||||||||||||||||||||||||||||||.|||||:||||||||||||||
  Fly   256 LLSSTSKYKVTIAEVQRRLSPPECLNASLLGGVLRRAKSKNGGRLLREKLEKIGLNLPAGRRKAA 320

Human   367 NVTLLTSLVEGEAVHLARDFGYVCETEFPAKAVAEFLNRQHSDPNEQVTRKNMLLATKQICKEFT 431
            |||||||||||||.|||:||.:||||||||:.:||::.|..::|.:...||.::|.::||.||..
  Fly   321 NVTLLTSLVEGEATHLAKDFHFVCETEFPARQLAEYIVRHQTEPQDSYRRKELILHSQQITKELM 385

Human   432 DLLAQDRSPLGNSRPNPILEPGIQSCLTHFNLISHGFGSPAVCAAVTALQNYLTEALKAMDKMYL 496
            .:|:|||:....:|...:|||.:|..||||:||:|||||||:.|.:.|.|.:|.|:|..::|:|.
  Fly   386 QILSQDRTTHFGTRSQHLLEPSMQRHLTHFSLITHGFGSPAIMAVLHAFQTFLNESLNYLEKLYP 450

Human   497 SNNPNSHTDNNAKSS-DKEEK 516
            ||.....:.:..||. |.|:|
  Fly   451 SNGGGMVSSSLDKSKIDNEKK 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TFAP2AXP_016866721.1 None
TfAP-2NP_001262178.1 TF_AP-2 247..441 CDD:397406 133/193 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165160186
Domainoid 1 1.000 277 1.000 Domainoid score I1732
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H2421
Inparanoid 1 1.050 321 1.000 Inparanoid score I2522
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D287275at33208
OrthoFinder 1 1.000 - - FOG0000991
OrthoInspector 1 1.000 - - otm40888
orthoMCL 1 0.900 - - OOG6_105211
Panther 1 1.100 - - O PTHR10812
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R10438
SonicParanoid 1 1.000 - - X400
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1312.930

Return to query results.
Submit another query.