DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TFAM and tHMG2

DIOPT Version :10

Sequence 1:NP_003192.1 Gene:TFAM / 7019 HGNCID:11741 Length:246 Species:Homo sapiens
Sequence 2:NP_001163689.1 Gene:tHMG2 / 42651 FlyBaseID:FBgn0038979 Length:134 Species:Drosophila melanogaster


Alignment Length:82 Identity:22/82 - (26%)
Similarity:44/82 - (53%) Gaps:10/82 - (12%)


- Green bases have known domain annotations that are detailed below.


Human    50 PKKPVSSYLRF----SKEQLPIFKAQNPDAKTTELIRRIAQRWRELPDSKKKIYQDAYRAEWQVY 110
            ||||:|:::.:    .::.:   :|::||....|:..:..:.||.:.|..|.::|::.......|
  Fly     9 PKKPMSAFMLWMNSTGRKNI---RAEHPDFSVQEVSVKGGEMWRAMADEHKIVWQESASKAMAEY 70

Human   111 KEEISR---FKEQLTPS 124
            ||::.:   |||..|.|
  Fly    71 KEKLEKWNAFKEHQTES 87

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TFAMNP_003192.1 HMG-box_TFAM_rpt1 50..115 CDD:438802 17/68 (25%)
HMG-box_TFAM_rpt2 135..234 CDD:438803
tHMG2NP_001163689.1 HMG-box_SSRP1-like 11..78 CDD:438810 15/69 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.